This site reproduces the NHLBI mpkCCD Proteome Database with a purpose to speed up the access. Permission for the reproduction was granted by the database owner Mark A. Knepper MD, PhD. The mpkCCD Cell Phosphoproteomic Database (mCPD) contains protein mass spectrometry data from the NHLBI Laboratory of Kidney and Electrolyte Metabolism. All data are obtained from a clonal mpkCCD cell line "clone 11" derived from mouse cortical collecting duct. Experiment description: The cells were grown on membrane supports until confluence and treated with the vasopessin V2 receptor specific agonist dDAVP for 3 days (1nM). After withdrawal of the hormone for 6h, cells were treated with dDAVP 0.1nM or vehicle for 30 min. All experiments were conducted using Stable Isotope Labeling by Amino-Acids in Cell culture (SILAC), which enables quantification of the hormone effect for a large number of peptides. If available, the ratio log2(dDAVP/vehicle) is given for the corresponding peptide. For more details, see the method section of the current paper (the reference will be added here upon publication of the manuscript). The mpkCCD Phosphoproteome Database was reproduced by Ming-Jiun Yu, PhD. |
Protein Name | Gene Name | Site | Peptide | Protein Link | log2(d/v) | log2(d/v) | log2(d/v) | p<0.05 |
AP2 associated kinase 1 isoform 1 | Aak1 | S635 | ILS*DVTHSAVFGVPASK | NP_001035195 | 7.85 | |||
AP2 associated kinase 1 isoform 1 | Aak1 | T618, S621 | VGSLT*PPS*SPK | NP_001035195 | -0.36 | -0.32 | ||
AP2 associated kinase 1 isoform 1 | Aak1 | T618, S621 | VGSLT*PPS*SPKTQR | NP_001035195 | -0.32 | |||
AP2 associated kinase 1 isoform 1 | Aak1 | T618, S622 | VGSLT*PPSS*PK | NP_001035195 | -0.58 | -0.38 | -0.32 | * |
AP2 associated kinase 1 isoform 1 | Aak1 | T604 | VQTT*PPPTIQGQK | NP_001035195 | -0.14 | |||
alanyl-tRNA synthetase | Aars | T72 | LSRAANT*QKCIRAGGK | NP_666329 | ||||
ATP-binding cassette, sub-family A (ABC1), member 2 | Abca2 | S628, T634 | IRQNS*SFTEKT*NEIR | NP_031405 | ||||
ATP-binding cassette, sub-family B, member 10 | Abcb10 | S27 | RGPAVRAWAPAVS*SR | NP_062425 | ||||
ATP-binding cassette, sub-family B (MDR/TAP), member 8 | Abcb8 | S491 | IVALVGQS*GGGK | NP_083296 | ||||
ATP-binding cassette, sub-family C, member 1 | Abcc1 | S290 | GSS*QLDVNEEVEALIVK | NP_032602 | -1.06 | |||
ATP-binding cassette, sub-family C (CFTR/MRP), member 12 | Abcc12 | S910 | LMNRFS*K | NP_766500 | ||||
ATP-binding cassette, sub-family C (CFTR/MRP), member 4 | Abcc4 | T646 | ENEEAEPSTAPGT*PTLR | NP_001028508 | -0.69 | |||
ATP-binding cassette, sub-family C (CFTR/MRP), member 4 | Abcc4 | T646 | KENEEAEPSTAPGT*PTLR | NP_001028508 | -0.08 | |||
ATP-binding cassette, sub-family F (GCN20), member 1 | Abcf1 | S138 | GGNVFEALIQDDS*EEEEEEEENR | NP_038882 | 0.31 | |||
ATP-binding cassette, sub-family F (GCN20), member 1 | Abcf1 | S107 | QLSVPAS*DEEDEVPAPIPR | NP_038882 | -0.03 | |||
ATP-binding cassette, sub-family F (GCN20), member 1 | Abcf1 | S194 | SKPAAADS*EGEEEEEDTAK | NP_038882 | 0.32 | -0.02 | -0.01 | |
ATP-binding cassette, sub-family F (GCN20), member 1 | Abcf1 | S194 | SKPAAADS*EGEEEEEDTAKEKEPPQQGK | NP_038882 | -0.16 | |||
c-abl oncogene 1, receptor tyrosine kinase isoform a | Abl1 | S16 | RPS*LPALHFIK | NP_001106174 | ||||
arg tyrosine kinase isoform a | Abl2 | S621 | STQASSGS*PALPR | NP_001129576 | -1.49 | |||
actin-binding LIM protein 1 isoform 2 | Ablim1 | S629 | GVS*MPNMLEPK | NP_001096647 | 0.37 | |||
actin-binding LIM protein 1 isoform 2 | Ablim1 | S510 | S*SGREEDEEELLR | NP_001096647 | ||||
actin-binding LIM protein 1 isoform 2 | Ablim1 | S376 | STS*QGSINSPVYSR | NP_001096647 | 0.58 | 0.61 | 0.05 | |
actin-binding LIM protein 1 isoform 2 | Ablim1 | T275 | T*SSESIYSRPGSSIPGSPGHTIYAK | NP_001096647 | -0.29 | |||
actin-binding LIM protein 1 isoform 2 | Ablim1 | S355, S359 | TLS*PTPS*AEGYQDVR | NP_001096647 | 1.58 | |||
actin-binding LIM protein 1 isoform 2 | Ablim1 | S355 | TLS*PTPSAEGYQDVR | NP_001096647 | -0.39 | -0.06 | -0.03 | |
actin-binding LIM protein 1 isoform 2 | Ablim1 | S276 | TS*SESIYSR | NP_001096647 | -0.58 | |||
actin-binding LIM protein 1 isoform 2 | Ablim1 | S276 | TS*SESIYSRPGSSIPGSPGHTIYAK | NP_001096647 | -0.02 | 0.04 | ||
actin-binding LIM protein 1 isoform 2 | Ablim1 | S277 | TSS*ESIYSRPGSSIPGSPGHTIYAK | NP_001096647 | 0.54 | -0.29 | ||
actin-binding LIM protein 1 isoform 2 | Ablim1 | S578 | TSS*LPGYGK | NP_001096647 | 0.33 | -0.41 | ||
androgen binding protein zeta | Abpz | T56 | ET*VAYEKIQDCYK | NP_803229 | ||||
centaurin, beta 2 | Acap2 | S381, S384 | SSPS*TGS*LDSGNESK | NP_084414 | 0.19 | |||
centaurin, beta 2 | Acap2 | T382, S384 | SSPST*GS*LDSGNESK | NP_084414 | 0.19 | |||
centaurin, beta 2 | Acap2 | T382 | SSPST*GSLDSGNESK | NP_084414 | 0.12 | |||
centaurin, beta 2 | Acap2 | S384 | SSPSTGS*LDSGNESK | NP_084414 | -0.11 | |||
acetyl-Coenzyme A acetyltransferase 3 | Acat3 | Y237, T245 | LKPY*FLTDGTGT*VTTANATGMNDGAAAVVLMKKTEAER | NP_694791 | ||||
apoptotic chromatin condensation inducer 1 isoform 3 | Acin1 | S81 | GVQAGNS*DTEGGQPGR | NP_001078941 | 0.4 | 0.01 | -0.22 | |
apoptotic chromatin condensation inducer 1 isoform 3 | Acin1 | T83 | GVQAGNSDT*EGGQPGR | NP_001078941 | 0.22 | 0.04 | -0.19 | |
apoptotic chromatin condensation inducer 1 isoform 3 | Acin1 | S141 | SLIPDIKPLAGQEAVVDLHADDSRIS*EDETER | NP_001078941 | 0.71 | |||
apoptotic chromatin condensation inducer 1 isoform 3 | Acin1 | S246 | TAQVPS*PPR | NP_001078941 | -0.02 | 0.14 | 0.08 | |
apoptotic chromatin condensation inducer 1 isoform 4 | Acin1 | T417 | APVVLQPEQIVSEEET*PPPLLTK | NP_001078942 | -0.06 | |||
apoptotic chromatin condensation inducer 1 isoform 4 | Acin1 | S729 | LQPEQGS*PK | NP_001078942 | -0.02 | |||
apoptotic chromatin condensation inducer 1 isoform 4 | Acin1 | S387, S391 | S*QSPS*PPPLPEDLEK | NP_001078942 | 0.3 | -0.08 | ||
apoptotic chromatin condensation inducer 1 isoform 4 | Acin1 | S479 | SLS*PLSGTTDTK | NP_001078942 | 0.22 | -0.2 | -0.02 | |
apoptotic chromatin condensation inducer 1 isoform 4 | Acin1 | S389, S391 | SQS*PS*PPPLPEDLEK | NP_001078942 | 0.13 | -0.1 | ||
apoptotic chromatin condensation inducer 1 isoform 4 | Acin1 | S389 | SQS*PSPPPLPEDLEK | NP_001078942 | 0.15 | |||
apoptotic chromatin condensation inducer 1 isoform 4 | Acin1 | S391 | SQSPS*PPPLPEDLEK | NP_001078942 | 0.18 | |||
apoptotic chromatin condensation inducer 1 isoform 4 | Acin1 | S216 | SSSFSEEKGES*DDEKPR | NP_001078942 | 0.5 | -0.18 | ||
ATP citrate lyase | Acly | T453 | T*ASFSESRADEVAPAKK | NP_598798 | 0.4 | |||
ATP citrate lyase | Acly | S455 | TAS*FSESRADEVAPAKK | NP_598798 | -0.1 | |||
acyl-CoA synthetase medium-chain family member 2A | Acsm2 | T556 | TVT*GKIER | NP_666309 | ||||
actin, beta | Actb | S365 | QEYDES*GPSIVHR | NP_031419 | ||||
actin, beta-like 2 | Actbl2 | S34 | AVFPS*MVGR | NP_780706 | ||||
actin, beta-like 2 | Actbl2 | S34 | AVFPS*MVGRPR | NP_780706 | ||||
actinin, alpha 1 | Actn1 | T490 | CQKICDQWDNLGALT*QKR | NP_598917 | ||||
ARP3 actin-related protein 3 homolog B | Actr3b | T113 | AEPEDHYFLMT*EPPLNTPENR | NP_001004365 | ||||
a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 10 | Adamts10 | T428 | T*NPFVWSSCSR | NP_766207 | -0.1 | |||
a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 16 | Adamts16 | Y1085 | YISGKY*R | NP_742050 | -2.77 | |||
adenylate cyclase 4 | Adcy4 | T202 | ALRAT*FREALSSLHSR | NP_536683 | >10 | |||
adducin 1 (alpha) isoform 1 | Add1 | S586 | QKGS*EENLDETR | NP_001019629 | 0.46 | |||
adducin 1 (alpha) isoform 1 | Add1 | S724 | TPS*FLK | NP_001019629 | -0.47 | |||
adducin 1 (alpha) isoform 1 | Add1 | S724 | TPS*FLKK | NP_001019629 | 0.51 | 0.19 | -0.42 | |
adducin 3 (gamma) | Add3 | S679 | TEEVLSPDGSPS*KSPSK | NP_038786 | -0.66 | |||
adducin 3 (gamma) | Add3 | S679 | TEEVLSPDGSPS*KSPSKK | NP_038786 | -0.69 | -0.61 | ||
adducin 3 (gamma) | Add3 | S681 | TEEVLSPDGSPSKS*PSK | NP_038786 | -0.56 | -0.62 | ||
adducin 3 (gamma) | Add3 | S681 | TEEVLSPDGSPSKS*PSKK | NP_038786 | -0.65 | |||
adducin 3 (gamma) | Add3 | S683 | TEEVLSPDGSPSKSPS*K | NP_038786 | -0.66 | |||
adrenomedullin 2 | Adm2 | S138 | RDS*APVDPSSPHSYG | NP_891558 | 0.33 | |||
adrenergic receptor, alpha 2c | Adra2c | T241 | VAKLRT*RTLSEKR | NP_031444 | 15.66 | |||
actin filament associated protein 1 | Afap1 | S666 | SGTSS*PQSPVFR | NP_081649 | -0.06 | |||
actin filament associated protein 1 | Afap1 | S669 | SGTSSPQS*PVFR | NP_081649 | 0.28 | |||
actin filament associated protein 1-like 2 | Afap1l2 | S428 | KFS*EPNTYIDGLPSR | NP_666214 | 7.44 | |||
actin filament associated protein 1-like 2 | Afap1l2 | S288 | KKS*TSLEPPER | NP_666214 | 0.39 | |||
actin filament associated protein 1-like 2 | Afap1l2 | Y357 | VAQQPLSLVGCDVLPDPSPDHLY*SFR | NP_666214 | -0.42 | |||
actin filament associated protein 1-like 2 | Afap1l2 | S358 | VAQQPLSLVGCDVLPDPSPDHLYS*FR | NP_666214 | 0.67 | |||
AF4/FMR2 family, member 4 | Aff4 | S174 | SS*SPGKPQAVSSLSSSHSR | NP_291043 | -0.08 | |||
AF4/FMR2 family, member 4 | Aff4 | S175 | SSS*PGKPQAVSSLSSSHSR | NP_291043 | -0.17 | |||
aftiphilin protein | Aftph | S151 | SFS*PGDFR | NP_852076 | -0.21 | |||
centaurin, gamma 3 | Agap3 | S478 | ATPTTAPGTS*PR | NP_631892 | -3.3 | |||
ATP/GTP binding protein-like 2 | Agbl2 | S797 | EKGTSLDPPLTS*PKNK | NP_848870 | ||||
ArfGAP with FG repeats 1 | Agfg1 | T177, S181 | GT*PSQS*PVVGR | NP_034602 | -3.96 | |||
ArfGAP with FG repeats 1 | Agfg1 | S181 | GTPSQS*PVVGR | NP_034602 | -3.99 | -1.52 | -1.45 | |
ArfGAP with FG repeats 1 | Agfg1 | T177, S181 | SLLGESAPALHLNKGT*PSQS*PVVGR | NP_034602 | 2.18 | |||
AT hook containing transcription factor 1 | Ahctf1 | Y1000 | SVTRNSILDQY*GK | NP_080651 | >10 | |||
AHNAK nucleoprotein isoform 3 | Ahnak | S94 | KGDRS*PEPGQTWTHEVFSSR | NP_001035048 | 0.12 | -0.32 | ||
AHNAK nucleoprotein isoform 3 | Ahnak | T100 | KGDRSPEPGQT*WTHEVFSSR | NP_001035048 | ||||
AHNAK nucleoprotein isoform 3 | Ahnak | T102 | KGDRSPEPGQTWT*HEVFSSR | NP_001035048 | ||||
AHNAK nucleoprotein isoform 3 | Ahnak | S94 | S*PEPGQTWTHEVF | NP_001035048 | ||||
AHNAK nucleoprotein isoform 3 | Ahnak | S94 | S*PEPGQTWTHEVFSSR | NP_001035048 | 0.02 | |||
AHNAK nucleoprotein isoform 1 | Ahnak | S893 | AES*PEMEVNLPK | NP_033773 | -0.42 | |||
AHNAK nucleoprotein isoform 1 | Ahnak | S5525 | ASLGS*LEGEVEAEASSPK | NP_033773 | 1.76 | |||
AHNAK nucleoprotein isoform 1 | Ahnak | S5536 | ASLGSLEGEVEAEASS*PK | NP_033773 | -1.22 | |||
AHNAK nucleoprotein isoform 1 | Ahnak | S5563, T5567 | EFS*APST*PTGTLEFAGGDAK | NP_033773 | -2.32 | |||
AHNAK nucleoprotein isoform 1 | Ahnak | T5567 | EFSAPST*PTGTLEFAGGDAK | NP_033773 | -1.79 | |||
AHNAK nucleoprotein isoform 1 | Ahnak | S4890 | FKAEAPLPS*PK | NP_033773 | -3.32 | -1 | ||
AHNAK nucleoprotein isoform 1 | Ahnak | S5099 | GDLGASS*PSMK | NP_033773 | -1.9 | |||
AHNAK nucleoprotein isoform 1 | Ahnak | S5504 | GGVTGS*PEASISGSK | NP_033773 | -0.77 | -0.93 | -0.49 | * |
AHNAK nucleoprotein isoform 1 | Ahnak | S5508 | GGVTGSPEAS*ISGSK | NP_033773 | -0.43 | |||
AHNAK nucleoprotein isoform 1 | Ahnak | S5510 | GGVTGSPEASIS*GSKGDLK | NP_033773 | -0.08 | |||
AHNAK nucleoprotein isoform 1 | Ahnak | T5605 | GHYEVT*GSDDEAGK | NP_033773 | -0.22 | |||
AHNAK nucleoprotein isoform 1 | Ahnak | S5607 | GHYEVTGS*DDEAGK | NP_033773 | -0.51 | -0.24 | ||
AHNAK nucleoprotein isoform 1 | Ahnak | S5607 | GHYEVTGS*DDEAGKLQGSGVSLASK | NP_033773 | -0.26 | |||
AHNAK nucleoprotein isoform 1 | Ahnak | S5504 | GKGGVTGS*PEASISGSK | NP_033773 | -0.6 | |||
AHNAK nucleoprotein isoform 1 | Ahnak | S211, S217 | LPS*GSGPAS*PTTGSAVDIR | NP_033773 | -1.37 | -0.27 | -0.39 | |
AHNAK nucleoprotein isoform 1 | Ahnak | S211, T219 | LPS*GSGPASPT*TGSAVDIR | NP_033773 | -0.42 | -0.36 | ||
AHNAK nucleoprotein isoform 1 | Ahnak | S211, T220 | LPS*GSGPASPTT*GSAVDIR | NP_033773 | -0.34 | |||
AHNAK nucleoprotein isoform 1 | Ahnak | S211 | LPS*GSGPASPTTGSAVDIR | NP_033773 | -0.33 | -0.8 | -0.79 | |
AHNAK nucleoprotein isoform 1 | Ahnak | S213, S217 | LPSGS*GPAS*PTTGSAVDIR | NP_033773 | -0.69 | -0.27 | -0.39 | |
AHNAK nucleoprotein isoform 1 | Ahnak | S213, T220 | LPSGS*GPASPTT*GSAVDIR | NP_033773 | -0.14 | -0.29 | ||
AHNAK nucleoprotein isoform 1 | Ahnak | S213 | LPSGS*GPASPTTGSAVDIR | NP_033773 | -0.8 | |||
AHNAK nucleoprotein isoform 1 | Ahnak | S217 | LPSGSGPAS*PTTGSAVDIR | NP_033773 | -0.8 | -0.23 | -0.33 | |
AHNAK nucleoprotein isoform 1 | Ahnak | T219 | LPSGSGPASPT*TGSAVDIR | NP_033773 | -0.33 | |||
AHNAK nucleoprotein isoform 1 | Ahnak | T220 | LPSGSGPASPTT*GSAVDIR | NP_033773 | -0.87 | |||
AHNAK nucleoprotein isoform 1 | Ahnak | S136 | LRS*EDGVEGDLGETQSR | NP_033773 | -1.02 | -0.12 | ||
AHNAK nucleoprotein isoform 1 | Ahnak | S217 | SGSGPAS*PTTGSAVDIR | NP_033773 | 0.24 | |||
AHNAK nucleoprotein isoform 1 | Ahnak | S5607 | SKGHYEVTGS*DDEAGK | NP_033773 | -0.43 | |||
AHNAK nucleoprotein isoform 1 | Ahnak | S5555 | SNS*FSDER | NP_033773 | 0.5 | |||
AHNAK nucleoprotein isoform 1 | Ahnak | S116 | SSEVVLS*GDDEDYQR | NP_033773 | -0.11 | |||
AHNAK nucleoprotein isoform 1 | Ahnak | T496 | VKT*PEMIIQKPK | NP_033773 | -0.96 | |||
aryl-hydrocarbon receptor repressor | Ahrr | T251, S253, T255 | T*PS*GT*ALPPR | NP_033774 | ||||
hypothetical protein LOC224833 | AI661453 | S368 | ALEPEQPREPRPETPGS*PR | NP_663464 | 0.16 | |||
hypothetical protein LOC224833 | AI661453 | S368 | EPRPETPGS*PR | NP_663464 | -0.39 | |||
hypothetical protein LOC224833 | AI661453 | S1131 | RLS*LEGAR | NP_663464 | 0.18 | 0.88 | 0.7 | |
hypothetical protein LOC224833 | AI661453 | S984 | SFSSPPS*PSYK | NP_663464 | -0.6 | |||
hypothetical protein LOC224833 | AI661453 | S529 | SPSSS*SLPER | NP_663464 | -0.51 | |||
calcium activated chloride channel | AI747448 | T686 | VRADGGT*NSARR | NP_001028371 | ||||
basophilic leukemia expressed protein BLES03 | AI837181 | S36 | ARS*WVGAER | NP_598910 | 1.63 | |||
membrane protein CH1 | AI848100 | S1073 | RTS*FPLIR | NP_766233 | 3.66 | |||
allograft inflammatory factor 1-like | Aif1l | S133 | ANES*SPKPAGPPPER | NP_660126 | -0.51 | |||
allograft inflammatory factor 1-like | Aif1l | S134 | ANESS*PKPAGPPPER | NP_660126 | -0.84 | -0.9 | -0.53 | * |
absent in melanoma 1-like | Aim1l | T215, S224 | NVT*RTVRAVVVS*PRAEGSPSR | NP_001156442 | ||||
small inducible cytokine subfamily E, member 1 | Aimp1 | S147 | QQS*AAASTDSKPIDASR | NP_031952 | ||||
A-kinase anchor protein 1 | Akap1 | S101 | RRS*ESSGNLPSVADTR | NP_001036006 | 2.04 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | S1645 | AEADASGNLTKES*PDTNGPK | NP_112462 | -0.74 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | T1648 | AEADASGNLTKESPDT*NGPK | NP_112462 | -0.66 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | S1292 | CQETESNEEQSIS*PEKR | NP_112462 | -0.64 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | S270 | EKEPTKPLES*PTSPVSNETTSSFK | NP_112462 | -0.88 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | T272 | EKEPTKPLESPT*SPVSNETTSSFK | NP_112462 | -0.9 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | S273 | EKEPTKPLESPTS*PVSNETTSSFK | NP_112462 | -1.16 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | S221 | ESELKQS*TEKQEGTLK | NP_112462 | 0.24 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | T583 | GPSEAPQEAEAEEGAT*SDGEK | NP_112462 | -0.28 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | T583 | GPSEAPQEAEAEEGAT*SDGEKKR | NP_112462 | -0.5 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | S584 | GPSEAPQEAEAEEGATS*DGEK | NP_112462 | 0.18 | -0.05 | -0.24 | |
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | S584 | GPSEAPQEAEAEEGATS*DGEKK | NP_112462 | 0.07 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | S584 | GPSEAPQEAEAEEGATS*DGEKKR | NP_112462 | -0.51 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | S489 | HPEGIVSEVEMLSS*QER | NP_112462 | -1.03 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | S505 | KLFS*SSGLK | NP_112462 | -0.82 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | S506 | KLFSS*SGLK | NP_112462 | -0.83 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | S613 | RPS*ESDKEEELDK | NP_112462 | -0.39 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | S613 | RPS*ESDKEEELDKVK | NP_112462 | -0.29 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | S626, S631 | S*ATLSS*TESTASGMQDEVR | NP_112462 | 0.17 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | S630, S631, S637 | SATLS*S*TESTAS*GMQDEVR | NP_112462 | -0.24 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | S630, S631 | SATLS*S*TESTASGMQDEVR | NP_112462 | 0.11 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | S630, T632 | SATLS*ST*ESTASGMQDEVR | NP_112462 | 0.11 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | S631, T635 | SATLSS*TEST*ASGMQDEVR | NP_112462 | -0.15 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | S631, S637 | SATLSS*TESTAS*GMQDEVR | NP_112462 | -0.18 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | T632, S637 | SATLSST*ESTAS*GMQDEVR | NP_112462 | -0.18 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | S27 | SPEQPAESDTPSELELS*GHGPAAEASGAAGDPADADPATK | NP_112462 | -1.41 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | T344 | VDEEEGEKTEPAPAEEQEPAEGT*DQARLSADYEK | NP_112462 | -0.66 | |||
A kinase (PRKA) anchor protein (gravin) 12 | Akap12 | S350 | VDEEEGEKTEPAPAEEQEPAEGTDQARLS*ADYEK | NP_112462 | 0.46 | -1.15 | ||
A kinase (PRKA) anchor protein 13 | Akap13 | S1892 | FLSHS*TDSLNK | NP_083608 | -0.06 | |||
A-kinase anchor protein 4 isoform b | Akap4 | S624 | MDMSNMVLS*LIQK | NP_001036007 | <-10 | |||
A kinase anchor protein 8 | Akap8 | S320, S325 | ADS*DGDLS*ENDDGAGDLR | NP_062748 | -0.01 | |||
A kinase anchor protein 8 | Akap8 | S336 | S*GDEEFRGEDDLCDSR | NP_062748 | ||||
akirin 2 | Akirin2 | T184 | FT*HDQIMR | NP_001007590 | 2.88 | |||
akirin 2 | Akirin2 | S21 | TLDFDPLLSPAS*PK | NP_001007590 | -0.14 | |||
AKT1 substrate 1 (proline-rich) | Akt1s1 | T247 | LNT*SDFQK | NP_080546 | -6.19 | 0.24 | 0.3 | |
AKT1 substrate 1 (proline-rich) | Akt1s1 | S184 | S*LPVSVPVWAFK | NP_080546 | 0.61 | -0.12 | ||
pyrroline-5-carboxylate synthetase isoform 1 | Aldh18a1 | T760 | IHARGPVGLEGLLTT*K | NP_062672 | >10 | |||
aldolase C, fructose-bisphosphate | Aldoc | S39 | GILAADESVGS*MAK | NP_033787 | ||||
AlkB homolog 3 | Alkbh3 | S28 | SQSATQPAS*PAR | NP_081220 | -1.91 | |||
alkB, alkylation repair homolog 5 | Alkbh5 | S385 | KSYESSEDCPEAASS*PTR | NP_766531 | 0.57 | 0.1 | ||
alkB, alkylation repair homolog 5 | Alkbh5 | S362 | RGS*FSSENYWR | NP_766531 | 0.96 | 0.46 | 0.65 | * |
alkB, alkylation repair homolog 5 | Alkbh5 | S364 | RGSFS*SENYWR | NP_766531 | 0.63 | |||
alkB, alkylation repair homolog 5 | Alkbh5 | S385 | SYESSEDCPEAASS*PTR | NP_766531 | 0.37 | |||
alkB, alkylation repair homolog 5 | Alkbh5 | S385 | SYESSEDCPEAASS*PTRK | NP_766531 | 0.47 | |||
alkB, alkylation repair homolog 5 | Alkbh5 | Y61 | Y*QEDSDPERSDYEEHQLQK | NP_766531 | ||||
alkB, alkylation repair homolog 5 | Alkbh5 | S65 | YQEDS*DPERSDYEEHQLQK | NP_766531 | -0.01 | -0.12 | ||
Alstrom syndrome 1 | Alms1 | S1480 | ES*FVEEVPHIEYVQK | NP_660258 | ||||
Alstrom syndrome 1 | Alms1 | S2977 | MVS*KGVQAGNLEIVAGVKK | NP_660258 | ||||
alpha-kinase 2 | Alpk2 | T1536, Y1540 | AETNNST*GHIY*GGSEPRTR | NP_001032371 | ||||
angiomotin | Amot | S605, T610, T612 | TGS*RDCST*QT*ER | NP_695231 | ||||
angiomotin-like 1 | Amotl1 | S496, S500, T501, T502 | ELQSISEAYES*LVKS*T*T*KR | NP_001074864 | ||||
angiomotin like 2 | Amotl2 | S647 | S*RKDPGKATQGTLRPAK | NP_062738 | ||||
angiomotin like 2 | Amotl2 | T655 | SRKDPGKAT*QGTLRPAK | NP_062738 | ||||
adenosine monophosphate deaminase 3 | Ampd3 | S83 | S*QSLSLQMPTQQDWK | NP_033797 | -0.42 | |||
adenosine monophosphate deaminase 3 | Ampd3 | S85 | SQS*LSLQMPTQQDWK | NP_033797 | -0.48 | |||
amylase 2b, pancreatic | Amy2b | T175 | NCRLT*GLLDLALEKDYVR | NP_001036176 | ||||
angiopoietin-like 3 | Angptl3 | Y417 | Y*NKPRTKSRPER | NP_038941 | ||||
ankyrin repeat domain protein 17 isoform a | Ankrd17 | Y2034, S2043 | EHY*PVSSPSSPS*PPAQPGGVSR | NP_112148 | -0.04 | |||
ankyrin repeat domain protein 17 isoform a | Ankrd17 | S2037, S2043 | EHYPVS*SPSSPS*PPAQPGGVSR | NP_112148 | -0.19 | |||
ankyrin repeat domain protein 17 isoform a | Ankrd17 | S2040, S2043 | EHYPVSSPS*SPS*PPAQPGGVSR | NP_112148 | 0.01 | |||
anillin | Anln | S180 | AAS*PSKPPISNASATPVGR | NP_082666 | -0.86 | |||
anillin | Anln | S73 | SCTKPSPSKKRCS*DK | NP_082666 | ||||
anillin | Anln | T322, T332, S334 | TASPLKT*EARKPCEKPT*LS*QGAQPK | NP_082666 | >10 | |||
annexin A1 | Anxa1 | T272 | CAT*STPAFFAEK | NP_034860 | ||||
annexin A6 isoform b | Anxa6 | S622 | VMVS*RSEIDLLNIR | NP_001103681 | 0.55 | |||
synergin, gamma isoform 1 | Ap1gbp1 | S1067 | SLS*LGDKEISR | NP_001108481 | ||||
adaptor-related protein complex 3, delta 1 subunit | Ap3d1 | T758 | HSSLPT*ESDEDIAPAQR | NP_031486 | -0.46 | |||
adaptor-related protein complex 3, delta 1 subunit | Ap3d1 | S760 | HSSLPTES*DEDIAPAQR | NP_031486 | -0.55 | -0.46 | ||
adaptor-related protein complex 3, delta 1 subunit | Ap3d1 | S784 | VDIITEEMPENALPS*DEDDKDPNDPYR | NP_031486 | 1.56 | |||
adenomatosis polyposis coli down-regulated 1 | Apcdd1 | S34 | S*HPRSLEKSAWR | NP_573500 | ||||
APEX nuclease 1 | Apex1 | S18 | AAADDGEEPKS*EPETK | NP_033817 | 0 | |||
APEX nuclease 1 | Apex1 | S18 | AAADDGEEPKS*EPETKK | NP_033817 | -0.32 | |||
APEX nuclease 1 | Apex1 | T22 | AAADDGEEPKSEPET*KK | NP_033817 | 3.4 | |||
APEX nuclease 1 | Apex1 | S18 | KAAADDGEEPKS*EPETK | NP_033817 | -0.22 | |||
apurinic/apyrimidinic endonuclease 2 | Apex2 | S504, S505 | GPPSDPS*S*R | NP_084219 | ||||
apoptosis inhibitor 5 | Api5 | S464 | TSEDTSSGS*PPK | NP_031492 | 1.19 | |||
apoptosis inhibitor 5 | Api5 | S464 | TSEDTSSGS*PPKKSPGGPK | NP_031492 | 0.19 | |||
aquaporin 2 | Aqp2 | S256, S261, S264 | QS*VELHS*PQS*LPR | NP_033829 | ||||
aquaporin 2 | Aqp2 | S256, S261 | QS*VELHS*PQSLPR | NP_033829 | ||||
aquaporin 2 | Aqp2 | S256, S264 | QS*VELHSPQS*LPR | NP_033829 | ||||
aquaporin 2 | Aqp2 | S256 | QS*VELHSPQSLPR | NP_033829 | ||||
aquaporin 2 | Aqp2 | S261 | QSVELHS*PQSLPR | NP_033829 | -7.79 | |||
aquaporin 2 | Aqp2 | S256, S261 | RQS*VELHS*PQSLPR | NP_033829 | -5.1 | -3.99 | ||
aquaporin 2 | Aqp2 | S256, S264 | RQS*VELHSPQS*LPR | NP_033829 | 0.51 | |||
aquaporin 2 | Aqp2 | S256 | RQS*VELHSPQSLPR | NP_033829 | 1.84 | 0.11 | ||
aquaporin 2 | Aqp2 | S256, S269 | RQS*VELHSPQSLPRGS*KA | NP_033829 | 13.27 | |||
aquaporin 2 | Aqp2 | S261, S264 | RQSVELHS*PQS*LPR | NP_033829 | ||||
aquaporin 2 | Aqp2 | S261 | RQSVELHS*PQSLPR | NP_033829 | -6.14 | |||
aquaporin 2 | Aqp2 | S264 | RQSVELHSPQS*LPR | NP_033829 | 3.35 | |||
aquaporin 2 | Aqp2 | S256, S261 | RRQS*VELHS*PQSLPR | NP_033829 | -4.08 | |||
aquaporin 2 | Aqp2 | S256, S264 | RRQS*VELHSPQS*LPR | NP_033829 | 0.42 | |||
aquaporin 2 | Aqp2 | S256 | RRQS*VELHSPQSLPR | NP_033829 | 0.99 | |||
aquaporin 2 | Aqp2 | S261 | RRQSVELHS*PQSLPR | NP_033829 | ||||
v-raf murine sarcoma 3611 viral oncogene homolog isoform 1 | Araf | S255, S263 | GS*PSPASVSS*GR | NP_033833 | ||||
ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 | Arap2 | S343, S348 | LES*SKKRS*IK | NP_848494 | ||||
ADP-ribosylation factor GTPase activating protein 2 | Arfgap2 | S431 | AIS*SDMFFGR | NP_076343 | -1.49 | -0.27 | 0.12 | |
ADP-ribosylation factor GTPase activating protein 2 | Arfgap2 | S432 | AISS*DMFFGR | NP_076343 | -0.27 | |||
ADP-ribosylation factor GTPase activating protein 2 | Arfgap2 | S145 | HGTDLWIDSMNSAPSHS*PEK | NP_076343 | ||||
ADP-ribosylation factor GTPase activating protein 2 | Arfgap2 | S145 | HGTDLWIDSMNSAPSHS*PEKK | NP_076343 | -0.01 | |||
ADP-ribosylation factor GTPase activating protein 2 | Arfgap2 | Y357, S363, S370 | Y*KDNPFS*LGETFGS*R | NP_076343 | ||||
ADP-ribosylation factor guanine nucleotide-exchange factor 1(brefeldin A-inhibited) | Arfgef1 | S1566 | S*VDIHDSIQPR | NP_001095900 | -0.62 | -0.3 | ||
ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) | Arfgef2 | S227 | ELEKPMQSKPQSPVIQATAGS*PK | NP_001078964 | -0.07 | |||
ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) | Arfgef2 | S227 | PQSPVIQATAGS*PK | NP_001078964 | -0.09 | |||
ADP-ribosylation factor interacting protein 1 | Arfip1 | S132 | KWS*LNTYK | NP_001074562 | -0.41 | |||
Rho GTPase activating protein 1 isoform 1 | Arhgap1 | S91 | SSS*PEPVTHLK | NP_001139374 | 0.53 | 0.07 | ||
nadrin isoform b | Arhgap17 | T736, S739 | LGEQGPEPGPTPPQTPT*PPS*TPPLAK | NP_001116112 | -1.1 | -0.43 | ||
nadrin isoform b | Arhgap17 | T736, T740 | LGEQGPEPGPTPPQTPT*PPST*PPLAK | NP_001116112 | -0.64 | -0.46 | ||
Rho GTPase activating protein 21 isoform 2 | Arhgap21 | S1848 | VRTS*ASDLSR | NP_001074833 | -0.06 | |||
Rho GTPase activating protein 27 isoform 1 | Arhgap27 | S259, S260 | KS*S*QDSDTPAQASPPEEK | NP_598476 | 1.95 | |||
Rho GTPase activating protein 27 isoform 1 | Arhgap27 | S259, S263 | KS*SQDS*DTPAQASPPEEK | NP_598476 | 1.12 | |||
Rho GTPase activating protein 27 isoform 1 | Arhgap27 | S259 | KS*SQDSDTPAQASPPEEK | NP_598476 | 1.35 | 1.25 | ||
Rho GTPase activating protein 27 isoform 1 | Arhgap27 | S260 | KSS*QDSDTPAQASPPEEK | NP_598476 | 1.28 | |||
Rho GTPase activating protein 27 isoform 1 | Arhgap27 | S263, T265 | KSSQDS*DT*PAQASPPEEK | NP_598476 | 0.22 | |||
Rho GTPase activating protein 29 | Arhgap29 | S1149 | RSS*DSCPATAVR | NP_766113 | 1.85 | |||
Rho guanine nucleotide exchange factor 12 | Arhgef12 | S309 | TDWSSGDASRPSSDSADS*PK | NP_081420 | -0.56 | |||
Rho guanine nucleotide exchange factor (GEF) 15 | Arhgef15 | T582, S586 | MLLQNILSQT*EEGS*SR | NP_808234 | ||||
Rho guanine nucleotide exchange factor (GEF) 16 | Arhgef16 | S231 | GLNTS*HESDDDILDEPSGPVGTQR | NP_001106215 | -0.05 | |||
Rho guanine nucleotide exchange factor (GEF) 16 | Arhgef16 | S234 | GLNTSHES*DDDILDEPSGPVGTQR | NP_001106215 | -0.04 | |||
Rho guanine nucleotide exchange factor (GEF) 16 | Arhgef16 | S111 | HQS*FGAAVLSK | NP_001106215 | -0.06 | |||
Rho guanine nucleotide exchange factor (GEF) 17 | Arhgef17 | T692 | ALVSPET*PPTPGALRRR | NP_001074585 | ||||
rho/rac guanine nucleotide exchange factor (GEF) 2 | Arhgef2 | S931 | EAQELGS*PEDR | NP_032513 | 0.46 | |||
rho/rac guanine nucleotide exchange factor (GEF) 2 | Arhgef2 | S955 | LQDSSDPDTGSEEEVSSRLS*PPHSPR | NP_032513 | 1.48 | |||
rho/rac guanine nucleotide exchange factor (GEF) 2 | Arhgef2 | S174 | QILSQS*TDSLNMR | NP_032513 | -0.84 | 0.59 | ||
rho/rac guanine nucleotide exchange factor (GEF) 2 | Arhgef2 | S885 | S*LPAGDALYLSFNPPQPSR | NP_032513 | 1.62 | |||
rho/rac guanine nucleotide exchange factor (GEF) 2 | Arhgef2 | S151 | SVS*TTNIAGHFNDESPLGLR | NP_032513 | -0.19 | |||
PAK-interacting exchange factor beta isoform a | Arhgef7 | S673 | KPS*DEEFAVR | NP_001106989 | 1.3 | 1.11 | ||
PAK-interacting exchange factor beta isoform a | Arhgef7 | S497 | MS*GFIYQGK | NP_001106989 | 0.09 | -0.49 | ||
AT rich interactive domain 1B (Swi1 like) | Arid1b | S1757 | SS*PALAAPDASVDPK | NP_001078824 | 0.19 | |||
SVH protein | Armc10 | S43 | S*AEDLTDGSYDDILNAEQLK | NP_080310 | 0.54 | |||
SVH protein | Armc10 | S43 | S*AEDLTDGSYDDILNAEQLKK | NP_080310 | 0.66 | |||
armadillo repeat containing, X-linked 1 | Armcx1 | S206 | FSFPYKIDDILS*APDLQKVLNILER | NP_084342 | ||||
armadillo repeat containing, X-linked 3 | Armcx3 | Y298 | KEY*KEVILK | NP_082146 | ||||
aryl hydrocarbon receptor nuclear translocator isoform a | Arnt | S77 | FARS*DDEQSSADKER | NP_001032826 | 0.05 | |||
ADP-ribosyltransferase 1 | Art1 | S13 | IPAMMSLLLVS*VGLR | NP_033840 | ||||
armadillo repeat gene deleted in velo-cardio-facial syndrome | Arvcf | T643 | NFDT*LDLPK | NP_258435 | 0.72 | |||
armadillo repeat gene deleted in velo-cardio-facial syndrome | Arvcf | S914 | RTLGS*DSTGDTSEKELLRPDPGR | NP_258435 | ||||
polycomb group protein ASXH2 homolog | Asxl2 | S366, S370, S373 | S*ILPS*EAS*PVR | NP_766009 | ||||
ATPase family, AAA domain containing 5 | Atad5 | S258, S263, Y264 | ADLKES*TITVS*Y*EEFVKSHK | NP_001025027 | ||||
ATPase family, AAA domain containing 5 | Atad5 | S238 | LTKPS*LAEENDSRTHATK | NP_001025027 | ||||
activating transcription factor 2 isoform 1 | Atf2 | S94 | LDLS*PLATPIIR | NP_001020264 | -0.08 | |||
activating transcription factor 2 isoform 1 | Atf2 | T51, T53 | NDSVIVADQT*PT*PTR | NP_001020264 | -0.78 | |||
activating transcription factor 7 | Atf7 | T51, T53 | TDSVIIADQT*PT*PTR | NP_666177 | -1.58 | |||
activating transcription factor 7 interacting protein | Atf7ip | S112 | NKQEDLNSEALS*PSITCDLSSR | NP_062299 | -0.23 | |||
ATG2 autophagy related 2 homolog B | Atg2b | S239 | S*SPVCSTAPVETEPK | NP_083930 | -0.01 | |||
ATG2 autophagy related 2 homolog B | Atg2b | S240 | SS*PVCSTAPVETEPK | NP_083930 | 0.01 | |||
5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase | Atic | S475 | VLS*MKFK | NP_080471 | ||||
ataxia telangiectasia mutated | Atm | S1421, Y1422 | SILEILSKIPDS*Y*QK | NP_031525 | ||||
dentatorubral pallidoluysian atrophy | Atn1 | S630 | RAPS*PGSYK | NP_031907 | 0.5 | |||
ATPase, class V, type 10A | Atp10a | T1439 | GAISEVCPGDSKRQSTSASQT*AR | NP_033858 | ||||
plasma membrane calcium ATPase 1 | Atp2b1 | S1155 | IEDS*EPHIPLIDDTDAEDDAPTK | NP_080758 | 0.86 | -0.28 | ||
plasma membrane calcium ATPase 1 | Atp2b1 | S1155 | IEDS*EPHIPLIDDTDAEDDAPTKR | NP_080758 | 0.08 | -0.24 | ||
plasma membrane calcium ATPase 1 | Atp2b1 | T1165 | IEDSEPHIPLIDDT*DAEDDAPTKR | NP_080758 | ||||
plasma membrane calcium ATPase 1 | Atp2b1 | S1140 | SS*IHNFMTHPEFR | NP_080758 | ||||
ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform 1 | Atp5a1 | T46, T48, S52 | T*GT*AEMS*SILEER | NP_031531 | 8.1 | |||
ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform 1 | Atp5a1 | T46, T48, S53 | T*GT*AEMSS*ILEER | NP_031531 | 8.18 | |||
ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform 1 | Atp5a1 | T48, S52 | TGT*AEMS*SILEER | NP_031531 | ||||
ATPase, H+ transporting, lysosomal accessory protein 2 | Atp6ap2 | S254, S269, T272 | FADDMYS*LYGGNAVVELVTVKS*FDT*SLVR | NP_081715 | ||||
ATPase, H+ transporting, lysosomal accessory protein 2 | Atp6ap2 | Y256, S269, T272 | FADDMYSLY*GGNAVVELVTVKS*FDT*SLVR | NP_081715 | ||||
ATPase, aminophospholipid transporter-like, class I, type 8A, member 2 | Atp8a2 | T503 | LGFVFT*GR | NP_056618 | ||||
alpha thalassemia/mental retardation syndrome X-linked homolog | Atrx | Y89 | Y*VESDDEKPTDENVNEK | NP_033556 | 0.02 | |||
alpha thalassemia/mental retardation syndrome X-linked homolog | Atrx | S92 | YVES*DDEKPTDENVNEK | NP_033556 | 0.32 | -0.21 | -0.14 | |
ataxin 1 | Atxn1 | S751 | RWS*APETR | NP_033150 | 0.59 | |||
ataxin 2 | Atxn2 | T710 | ALT*PSIEAK | NP_033151 | -0.62 | -0.72 | -1.12 | * |
ataxin 2-like | Atxn2l | S597 | EKEVDGLLTSDPMGS*PVSSK | NP_898841 | -0.35 | |||
ataxin 2-like | Atxn2l | S597 | EVDGLLTSDPMGS*PVSSK | NP_898841 | -0.55 | -0.39 | -0.16 | |
ataxin 2-like | Atxn2l | S753 | GAKGS*LPPQR | NP_898841 | ||||
ataxin 2-like | Atxn2l | S453 | MYPPRS*PK | NP_898841 | 0.34 | |||
ataxin 2-like | Atxn2l | S337 | QGSGRES*PSLVSR | NP_898841 | -1.33 | 0.36 | ||
ataxin 2-like | Atxn2l | T686 | STSTPT*SPGPR | NP_898841 | -0.85 | |||
ataxin 2-like | Atxn2l | S637 | TESILDKEDKVPMAGVGGTEGPEQLPAPCPSQTGS*PPVGLIK | NP_898841 | -0.26 | |||
ataxin 7-like 1 isoform 1 | Atxn7l1 | S315 | SLTCKTHS*LSHRR | NP_001028608 | ||||
ataxin 7-like 2 | Atxn7l2 | T690 | CST*LKSKAH | NP_780392 | ||||
nuclear cap binding protein subunit 1, 80kDa | AU014645 | S22 | KTS*DANETEDHLESLICK | NP_001028373 | 1.98 | |||
hypothetical protein LOC102991 | AU022751 | T267, S269, S270, S271 | VPVAPSSTT*RS*S*S*DR | NP_001028383 | ||||
PREDICTED: hypothetical protein LOC269700 isoform 1 | AU042671 | T2273 | TEGT*PPPPGQPAK | XP_132325 | 0.27 | -0.09 | ||
hypothetical protein LOC330361 | AW146020 | S169 | SNEEDPES*DPDDHEKR | NP_808552 | -0.14 | |||
hypothetical protein LOC217882 | AW555464 | S1166 | AGS*FTGPSDSETAPAR | NP_001019773 | 0.49 | |||
hypothetical protein LOC217882 | AW555464 | S478 | LGNTS*PVPR | NP_001019773 | ||||
hypothetical protein LOC227624 | B230208H17Rik | S594, T597 | EDLS*DVT*DEDTGPAQPPPPSK | NP_001019787 | 0.02 | |||
hypothetical protein LOC227624 | B230208H17Rik | S502 | VAPQQCS*EPETK | NP_001019787 | -0.34 | |||
hypothetical protein LOC627214 | B830028B13Rik | T89 | KYMT*VPARR | NP_001137274 | ||||
hypothetical protein LOC627214 | B830028B13Rik | S3, S6 | MVS*KDS*GR | NP_001137274 | ||||
BCL2-associated agonist of cell death | Bad | S112 | HSS*YPAGTEEDEGMEEELSPFR | NP_031548 | 0.96 | |||
BCL2-associated agonist of cell death | Bad | S155 | RMS*DEFEGSFK | NP_031548 | 0.74 | 0.7 | ||
BCL2-associated agonist of cell death | Bad | S136 | S*APPNLWAAQR | NP_031548 | 1.81 | |||
BCL2-associated agonist of cell death | Bad | S134 | S*RSAPPNLWAAQR | NP_031548 | 0.45 | 0.47 | ||
BCL2-associated agonist of cell death | Bad | S136 | SRS*APPNLWAAQR | NP_031548 | 1.34 | |||
BCL2-associated athanogene 3 | Bag3 | S270, S274 | AAS*PFRS*PVR | NP_038891 | -0.18 | |||
brain-specific angiogenesis inhibitor 1-associated protein 2 isoform c | Baiap2 | S326 | SS*SMAAGLER | NP_001032843 | 0.19 | -0.22 | ||
brain-specific angiogenesis inhibitor 1-associated protein 2 isoform c | Baiap2 | S327 | SSS*MAAGLER | NP_001032843 | 0.27 | -0.14 | ||
BAI1-associated protein 2-like 1 | Baiap2l1 | S281 | DYDTLSKYS*PK | NP_080109 | -3.01 | |||
BAI1-associated protein 2-like 1 | Baiap2l1 | S278 | MIGKDYDTLS*KYSPK | NP_080109 | ||||
BAI1-associated protein 2-like 1 | Baiap2l1 | S281 | MIGKDYDTLSKYS*PK | NP_080109 | -1.96 | |||
BAI1-associated protein 2-like 1 | Baiap2l1 | S421 | SIS*TVDLTEK | NP_080109 | 0.27 | -0.71 | ||
BRCA1 associated RING domain 1 | Bard1 | Y148 | KVRY*VVTK | NP_031551 | ||||
brain abundant, membrane attached signal protein 1 | Basp1 | S92 | AEPEKS*EGAAEEQPEPAPAPEQEAAAPGPAAGGEAPK | NP_081671 | -0.51 | |||
HLA-B associated transcript 2 | Bat2 | S454 | KQS*SSEISLAVER | NP_064411 | 1.84 | |||
HLA-B associated transcript 2 | Bat2 | S1217 | LISGPLS*PMSR | NP_064411 | -1.36 | |||
BAT2 domain containing 1 | Bat2d | T2625 | AFGSGIDIKPGT*PPIGGR | NP_001074759 | -6.51 | -0.78 | ||
BAT2 domain containing 1 | Bat2d | T2634 | STT*PTSSPFR | NP_001074759 | -0.53 | |||
HLA-B-associated transcript 3 | Bat3 | S995 | ENAS*PAPGTTAEEAMSR | NP_476512 | -0.06 | |||
bromodomain adjacent to zinc finger domain, 1B | Baz1b | T440 | QMT*LLDMAKGTQKMTRTPR | NP_035844 | ||||
bromodomain adjacent to zinc finger domain, 1B | Baz1b | S1338 | RQS*LELQK | NP_035844 | ||||
bromodomain adjacent to zinc finger domain, 1B | Baz1b | S457 | S*SGGVPRSSGKPHK | NP_035844 | ||||
bromodomain adjacent to zinc finger domain, 1B | Baz1b | S458, S465 | SS*GGVPRSS*GKPHK | NP_035844 | ||||
HMG-BOX transcription factor BBX | Bbx | S811 | TADGRVS*PAGGTLDDKPK | NP_081720 | -0.18 | 0.07 | ||
HMG-BOX transcription factor BBX | Bbx | T816 | TADGRVSPAGGT*LDDKPK | NP_081720 | ||||
hypothetical protein LOC211556 | BC002199 | T225 | SKT*EEDILR | NP_666076 | -0.42 | |||
hypothetical protein LOC192173 | BC003940 | S21 | S*PTNSSEIFTPAHEENVR | NP_001028403 | ||||
hypothetical protein LOC192173 | BC003940 | T23 | SPT*NSSEIFTPAHEENVR | NP_001028403 | ||||
cDNA sequence BC005624 | BC005624 | T253 | VGDT*EKPEPERSPPNR | NP_659134 | 0.07 | |||
cDNA sequence BC005624 | BC005624 | S261 | VGDTEKPEPERS*PPNR | NP_659134 | 0.08 | 0.11 | ||
hypothetical protein LOC233057 | BC027344 | T261, S264 | SFT*LKS*NLTRHRR | NP_776099 | ||||
hypothetical protein LOC208768 | BC031781 | S269 | EDGIDAVEVAADRPGS*PR | NP_666055 | 0.69 | |||
hypothetical protein LOC231807 isoform 1 | BC037034 | S515 | S*QSFSHQQPSR | NP_001108487 | ||||
hypothetical protein LOC231807 isoform 1 | BC037034 | S517 | SQS*FSHQQPSR | NP_001108487 | -0.57 | |||
PREDICTED: similar to hCG1980844 | BC039210 | S1546 | RALPAHPGASS*GWR | XP_001481366 | ||||
mKIAA0540 protein | BC042396 | S2757, S2760 | RIS*QVS*SGETEYNPGEAR | XP_150243 | 0.19 | |||
mKIAA0540 protein | BC042396 | S2757, S2761 | RIS*QVSS*GETEYNPGEAR | XP_150243 | 0.19 | |||
breast cancer anti-estrogen resistance 3 | Bcar3 | S390 | TGEALRGS*DSQLCPKPPPKPCK | NP_038895 | -0.71 | |||
breast cancer anti-estrogen resistance 3 | Bcar3 | S365 | TGS*EPTLSPALVR | NP_038895 | 0.61 | 1.01 | ||
branched chain keto acid dehydrogenase E1, alpha polypeptide | Bckdha | S338 | IGHHS*TSDDSSAYR | NP_031559 | 0.85 | -0.3 | ||
branched chain keto acid dehydrogenase E1, alpha polypeptide | Bckdha | T339 | IGHHST*SDDSSAYR | NP_031559 | -0.3 | |||
branched chain ketoacid dehydrogenase kinase | Bckdk | S31 | S*TSATDTHHVELAR | NP_033869 | 0.92 | |||
branched chain ketoacid dehydrogenase kinase | Bckdk | T32 | ST*SATDTHHVELAR | NP_033869 | 0.63 | -0.01 | ||
branched chain ketoacid dehydrogenase kinase | Bckdk | S33 | STS*ATDTHHVELAR | NP_033869 | ||||
BCL2-like 13 | Bcl2l13 | T342 | AEKT*SPTPSVFVELGEEELEAVTARPEAVER | NP_705736 | -0.16 | |||
BCL2-like 13 | Bcl2l13 | S343 | AEKTS*PTPSVFVELGEEELEAVTARPEAVER | NP_705736 | -0.15 | |||
BCL2-like 13 | Bcl2l13 | T342 | T*SPTPSVFVELGEEELEAVTARPEAVER | NP_705736 | 0.56 | |||
B-cell CLL/lymphoma 9-like | Bcl9l | S21, S25 | EAPGS*PPLS*PR | NP_084532 | -1.16 | |||
B-cell CLL/lymphoma 9-like | Bcl9l | S116 | ERS*VSVDSGEQR | NP_084532 | 0.43 | |||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | Y381 | ADGDWDDQEVLDY*FSDKESAK | NP_001020563 | -0.17 | |||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | S383 | ADGDWDDQEVLDYFS*DKESAK | NP_001020563 | 0.48 | -0.16 | ||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | S387 | ADGDWDDQEVLDYFSDKES*AK | NP_001020563 | -0.34 | |||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | S510 | ELFDYS*PPLHK | NP_001020563 | 0.11 | 0.05 | ||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | S494 | EVQS*PEQVK | NP_001020563 | -0.08 | |||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | S395 | FHDS*EGDDTEETEDYR | NP_001020563 | 0.26 | -0.1 | ||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | S656 | IDIS*PSALR | NP_001020563 | -0.01 | 0.09 | 0.07 | |
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | S177 | KAEGEPQEES*PLK | NP_001020563 | -0.06 | 0.14 | ||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | S177 | KAEGEPQEES*PLKSK | NP_001020563 | -0.3 | |||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | S494 | KEVQS*PEQVK | NP_001020563 | -0.97 | |||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | S494 | KEVQS*PEQVKSEK | NP_001020563 | -0.15 | |||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | Y509 | LKELFDY*SPPLHK | NP_001020563 | -0.08 | |||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | S510 | LKELFDYS*PPLHK | NP_001020563 | -0.03 | 0.57 | ||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | T572, S576 | LLAST*LVHS*VKK | NP_001020563 | ||||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | S688 | LRCDS*ADLR | NP_001020563 | ||||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | S656 | RIDIS*PSALR | NP_001020563 | -0.07 | 0.39 | ||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | S658 | RIDISPS*ALR | NP_001020563 | 0.15 | |||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | S221 | SATSGDIWPGLSAYDNS*PR | NP_001020563 | -0.03 | |||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | S529 | SIFREES*PLR | NP_001020563 | 0.65 | 0.97 | ||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | S529 | SIFREES*PLRIK | NP_001020563 | ||||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | T305 | TIT*PQNAPR | NP_001020563 | -0.23 | |||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | Y283, S289 | Y*SPSQNS*PIHHIPSR | NP_001020563 | -0.5 | |||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | S284, S286 | YS*PS*QNSPIHHIPSR | NP_001020563 | 0.09 | |||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | S284, S289 | YS*PSQNS*PIHHIPSR | NP_001020563 | -0.38 | -0.03 | ||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | S284 | YS*PSQNSPIHHIPSR | NP_001020563 | ||||
BCL2-associated transcription factor 1 isoform 1 | Bclaf1 | S286, S289 | YSPS*QNS*PIHHIPSR | NP_001020563 | 0.4 | |||
breakpoint cluster region | Bcr | S122 | ASAPRPPPAPADGADPAPVEESEARPDGEGS*PSK | NP_001074881 | -0.62 | |||
beaded filament structural protein 1, in lens-CP94 | Bfsp1 | S563 | KEAEGS*R | NP_033881 | ||||
bicaudal D homolog 1 isoform 1 | Bicd1 | T576, T588, S589 | T*SSEPVSKENTET*S*K | NP_001106267 | ||||
bridging integrator 1 isoform 2 | Bin1 | S267, S273 | GNKSPS*PPPDGS*PAATPEIR | NP_001076803 | 0.01 | |||
Bloom syndrome protein homolog isoform 2 | Blm | T111, T114, T118, T127 | QQSKGTCSEPSLPAT*VQT*AQDT*LCTTPKTPT*AK | NP_001035992 | ||||
bone morphogenetic protein 1 | Bmp1 | T360 | ISVT*PGEK | NP_033885 | -0.12 | |||
bone morphogenetic protein 1 | Bmp1 | S303 | YEVNGVKPS*IGQRTR | NP_033885 | ||||
BMX non-receptor tyrosine kinase | Bmx | T38 | MSPNNYKERLFVLT*K | NP_033889 | ||||
BCL2/adenovirus E1B interacting protein 2 isoform alpha | Bnip2 | S114 | KGS*ITEYTATEEK | NP_001008239 | 0.29 | 0.27 | ||
BCL2/adenovirus E1B interacting protein 3 | Bnip3 | S88 | NSTLS*EEDYIER | NP_033890 | >10 | |||
BCL2/adenovirus E1B interacting protein 3-like | Bnip3l | S61 | NGGLEHVPS*SSSIHNGDMEK | NP_033891 | 0.37 | |||
BCL2/adenovirus E1B interacting protein 3-like | Bnip3l | S62 | NGGLEHVPSS*SSIHNGDMEK | NP_033891 | ||||
BCL2/adenovirus E1B interacting protein 3-like | Bnip3l | S63 | NGGLEHVPSSS*SIHNGDMEK | NP_033891 | 0.5 | |||
BCL2/adenovirus E1B interacting protein 3-like | Bnip3l | S64 | NGGLEHVPSSSS*IHNGDMEK | NP_033891 | 0.6 | |||
biorientation of chromosomes in cell division 1-like | Bod1l | S240 | KLSSQPS*TDVSTDKER | NP_001074891 | ||||
biorientation of chromosomes in cell division 1-like | Bod1l | S2995, S3000 | S*KAQLS*PSVKR | NP_001074891 | ||||
biorientation of chromosomes in cell division 1-like | Bod1l | S480, S482 | YYS*DS*DDELTVEQR | NP_001074891 | ||||
breast cancer 1 | Brca1 | S1665 | VVRS*IQERR | NP_033894 | ||||
bromodomain containing 1 | Brd1 | S1186 | VHGEPASDLS*DID | NP_001028446 | ||||
bromodomain containing 2 isoform b | Brd2 | S178, S181 | KADTTTPTPTAILAPGS*PAS*PPGSLEPK | NP_001020558 | -0.25 | |||
bromodomain containing 3 isoform 2 | Brd3 | S262 | SES*PPPLSEPK | NP_001107045 | -0.09 | 0.51 | 0.2 | |
bromodomain containing 4 isoform 1 | Brd4 | S471 | FAKMPDEPEEPVVTVSS*PAVPPPTK | NP_065254 | -4.02 | |||
bromodomain containing 4 isoform 1 | Brd4 | T1247 | HPT*TPSSTAK | NP_065254 | ||||
bromodomain containing 4 isoform 1 | Brd4 | S1153 | IHS*PIIR | NP_065254 | -2.16 | -0.21 | ||
bromodomain containing 4 isoform 1 | Brd4 | S602 | TKPPPTYES*EEEDK | NP_065254 | -0.27 | |||
transcription initiation factor IIIB | Brf1 | S552 | GGGS*PPRDDSQPPER | NP_082469 | 0.17 | -0.81 | ||
transcription initiation factor IIIB | Brf1 | S558 | GGGSPPRDDS*QPPER | NP_082469 | -0.12 | |||
BR serine/threonine kinase 1 | Brsk1 | T472, S473 | GGGSPT*S*K | NP_001003920 | ||||
Bartter syndrome, infantile, with sensorineural deafness (Barttin) | Bsnd | S260 | KQQWS*LR | NP_536706 | ||||
BUD13 homolog | Bud13 | T144, S148 | ARHDT*PDPS*PPR | NP_666112 | 0.19 | |||
BUD13 homolog | Bud13 | S238 | HDLDAS*PPR | NP_666112 | -0.24 | 0.2 | ||
BUD13 homolog | Bud13 | T196, S200 | HDT*PDLS*PPR | NP_666112 | -0.06 | |||
BUD13 homolog | Bud13 | T144, S148 | HDT*PDPS*PPR | NP_666112 | 0.04 | |||
BUD13 homolog | Bud13 | T144, S148 | HDT*PDPS*PPRK | NP_666112 | -0.02 | |||
BUD13 homolog | Bud13 | T183, S187 | HDT*PDPS*PPRR | NP_666112 | 0.62 | |||
BUD13 homolog | Bud13 | T131, T134 | HDT*PDT*SPPR | NP_666112 | 0.32 | |||
BUD13 homolog | Bud13 | T131, S135 | HDT*PDTS*PPR | NP_666112 | 0.2 | |||
BUD13 homolog | Bud13 | S148 | HDTPDPS*PPR | NP_666112 | 0.15 | -0.44 | ||
BUD13 homolog | Bud13 | T134 | HDTPDT*SPPR | NP_666112 | 0.19 | |||
BUD13 homolog | Bud13 | S135 | HDTPDTS*PPR | NP_666112 | 0.69 | 0.19 | ||
BUD13 homolog | Bud13 | S248 | KSHRNSS*AVSPR | NP_666112 | 0.9 | |||
BUD13 homolog | Bud13 | T196, S200 | VRHDT*PDLS*PPR | NP_666112 | 0.15 | |||
BUD13 homolog | Bud13 | T222, S226 | VRHDT*PDPS*PPR | NP_666112 | 0.08 | |||
BUD13 homolog | Bud13 | T131, S135 | VRHDT*PDTS*PPR | NP_666112 | 0.11 | |||
BUD13 homolog | Bud13 | S341, S344 | YEHDS*DLS*PPR | NP_666112 | 0.27 | |||
BUD13 homolog | Bud13 | S344 | YEHDSDLS*PPR | NP_666112 | -0.36 | |||
basic leucine zipper and W2 domains 1 | Bzw1 | S411 | NAEEES*ESEAEEGD | NP_080100 | ||||
hypothetical protein LOC238317 | C130039O16Rik | T647, S653 | SFEPPPYT*PPPILS*PVR | NP_001156973 | 0.36 | |||
hypothetical protein LOC243407 | C130060K24Rik | S364 | HGSS*GAMVMHRR | NP_780733 | ||||
complement component 1, q subcomponent, A chain | C1qa | T20 | VWT*VAEDVCR | NP_031598 | -0.3 | |||
PREDICTED: hypothetical protein LOC319463 | C230057M02Rik | S57, T67, T70 | WTLAISS*ASGCTRPDPT*NKT*HGR | XP_001478255 | ||||
hypothetical protein LOC97031 | C430004E15Rik | Y383 | KAPGNY*PLAGR | NP_780495 | ||||
hypothetical protein LOC97031 | C430004E15Rik | S501 | NGQEPVRPGLPVTFIDEVDS*EEEAFQEAK | NP_780495 | 0.2 | -0.24 | ||
hypothetical protein LOC97031 | C430004E15Rik | S457 | WQRPAS*PPPFLPATAEAEPAEGLGVPGLAK | NP_780495 | 0.1 | -0.52 | ||
hypothetical protein LOC217310 | C630004H02Rik | T591 | T*GSQEGTSMEGSRPAAPAEPGTLK | NP_780663 | 0 | |||
hypothetical protein LOC217310 | C630004H02Rik | S593 | TGS*QEGTSMEGSRPAAPAEPGTLK | NP_780663 | -1.13 | 0.85 | ||
hypothetical protein LOC97130 | C77080 | S600 | GLAVAPAS*PGK | NP_001028361 | -2.49 | -0.48 | ||
hypothetical protein LOC97130 | C77080 | S459 | GS*PSGGSTAETSDTASIR | NP_001028361 | 0.65 | |||
hypothetical protein LOC240067 | C920016K16Rik | T11, S20, S30 | QRMEPVT*FEDVAVNFS*LGEWALLDSS*QK | NP_001039024 | ||||
calcium binding protein 4 | Cabp4 | S37, S46 | S*KKESWHPGS*QK | NP_653115 | 11.28 | |||
calcium channel, voltage-dependent, R type, alpha 1E subunit | Cacna1e | S2017 | RSYHSS*LR | NP_033912 | ||||
carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase | Cad | S1859 | AS*DPGLPAEEPK | NP_076014 | 0.64 | |||
carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase | Cad | S1859 | IHRAS*DPGLPAEEPK | NP_076014 | 0.75 | -0.27 | ||
carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase | Cad | S1406 | RLS*SFVTK | NP_076014 | 4.27 | 1.77 | ||
carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase | Cad | Y2103, S2108, S2114 | Y*VAPPS*LRMPPS*VR | NP_076014 | ||||
caldesmon 1 | Cald1 | S248 | LKQTENAFS*PSR | NP_663550 | -0.02 | |||
calmodulin-like 3 | Calml3 | S27, T29, T30 | EAFSLFDKDGDGS*IT*T* | NP_081692 | ||||
calmodulin-like 3 | Calml3 | S27, T30 | EAFSLFDKDGDGS*ITT* | NP_081692 | ||||
calmodulin-like 3 | Calml3 | S27, T30 | EAFSLFDKDGDGS*ITT* | NP_081692 | ||||
calmodulin-like 3 | Calml3 | T29, T30 | EAFSLFDKDGDGSIT*T* | NP_081692 | ||||
calcium/calmodulin-dependent protein kinase II, delta isoform 2 | Camk2d | S330, T337 | KPDGVKES*TESSNTT*IEDEDVK | NP_001020609 | 0.02 | |||
calcium/calmodulin-dependent protein kinase II, delta isoform 2 | Camk2d | S330 | KPDGVKES*TESSNTTIEDEDVK | NP_001020609 | -0.19 | |||
calcium/calmodulin-dependent protein kinase II, delta isoform 2 | Camk2d | T331 | KPDGVKEST*ESSNTTIEDEDVK | NP_001020609 | 0.06 | |||
calcium/calmodulin-dependent protein kinase kinase 2, beta | Camkk2 | S99 | KMS*LQEPSQGGPASSSNSLDMNGR | NP_663333 | 3.39 | |||
calcium/calmodulin-dependent protein kinase kinase 2, beta | Camkk2 | S495 | S*FGNPFEGSR | NP_663333 | 2.53 | |||
calcium/calmodulin-dependent protein kinase kinase 2, beta | Camkk2 | S511 | SLS*APGNLLTK | NP_663333 | 5.23 | |||
calnexin | Canx | S582 | AEEDEILNRS*PR | NP_001103969 | 0.8 | 0.95 | 0.2 | * |
calnexin | Canx | S553, T561 | QKS*DAEEDGVT*GSQDEEDSKPK | NP_001103969 | -0.17 | |||
calnexin | Canx | S553, S563 | QKS*DAEEDGVTGS*QDEEDSKPK | NP_001103969 | ||||
calnexin | Canx | S553, S563 | QKS*DAEEDGVTGS*QDEEDSKPK | NP_001103969 | 0.09 | |||
calnexin | Canx | S553 | QKS*DAEEDGVTGSQDEEDSKPK | NP_001103969 | ||||
calnexin | Canx | S553 | QKS*DAEEDGVTGSQDEEDSKPK | NP_001103969 | 0.27 | 0.06 | ||
calnexin | Canx | T561 | SDAEEDGVT*GSQDEEDSKPK | NP_001103969 | 0.2 | |||
calnexin | Canx | S563 | SDAEEDGVTGS*QDEEDSKPK | NP_001103969 | 1.28 | 0.09 | ||
gelsolin-like capping protein isoform 2 | Capg | S338 | YSPNTQVEILPQGRES*PIFK | NP_001035999 | -0.24 | |||
cytoplasmic activation/proliferation-associated protein 1 isoform a | Caprin1 | T343 | SLT*PVAQSDPLVR | NP_001104759 | -0.93 | |||
calcium response factor | Carf | Y197, S206, T209 | GY*CVSETELES*VLT*FHK | NP_631889 | ||||
calcium-regulated heat-stable protein (24kD) | Carhsp1 | S31, S33 | DRS*PS*PLRGNVVPSPLPTR | NP_080097 | ||||
calcium-regulated heat-stable protein (24kD) | Carhsp1 | S42 | GNVVPS*PLPTR | NP_080097 | -0.6 | -0.15 | 0.17 | |
calcium-regulated heat-stable protein (24kD) | Carhsp1 | S42 | GNVVPS*PLPTRR | NP_080097 | 0.1 | |||
calcium-regulated heat-stable protein (24kD) | Carhsp1 | S53 | TFS*ATVR | NP_080097 | 0.06 | 0.07 | -0.06 | |
calcium-regulated heat-stable protein (24kD) | Carhsp1 | T55 | TFSAT*VR | NP_080097 | ||||
calcium-regulated heat-stable protein (24kD) | Carhsp1 | S42 | VVPS*PLPTR | NP_080097 | -0.08 | |||
cancer susceptibility candidate 3 | Casc3 | S262 | FGS*SPQRDPNWIGDR | NP_619601 | -0.08 | |||
cancer susceptibility candidate 3 | Casc3 | T140 | GTVT*GERQSGDGQESTEPVENK | NP_619601 | 0.09 | |||
cancer susceptibility candidate 3 | Casc3 | S145 | GTVTGERQS*GDGQESTEPVENK | NP_619601 | 0.22 | -0.15 | ||
cancer susceptibility candidate 5 | Casc5 | S60 | RVS*FADTIK | NP_083893 | 0.78 | |||
caspase 8 | Casp8 | S188 | RMS*LEGR | NP_001073595 | 2.09 | |||
calpastatin | Cast | S185 | EQKPFTPAS*PVQSTPSKPSDK | NP_033947 | -1.03 | -0.9 | ||
core-binding factor, runt domain, alpha subunit 2, translocated to, 2 homolog isoform 2 | Cbfa2t2 | T241 | DT*VPPEPPAKR | NP_033953 | ||||
chromobox homolog 5 | Cbx5 | S92 | KS*SFSNSADDIK | NP_001070257 | 2.81 | 1.12 | ||
chromobox homolog 5 | Cbx5 | S93 | KSS*FSNSADDIK | NP_001070257 | 2.73 | 1.42 | 1.5 | * |
chromobox homolog 5 | Cbx5 | S95 | KSSFS*NSADDIK | NP_001070257 | 1.31 | |||
chromobox homolog 5 | Cbx5 | S92 | S*SFSNSADDIK | NP_001070257 | 3.13 | 1.38 | 1.25 | |
chromobox homolog 5 | Cbx5 | S93 | SS*FSNSADDIK | NP_001070257 | 2.8 | 1.54 | 1.4 | * |
chromobox homolog 5 | Cbx5 | S95 | SSFS*NSADDIK | NP_001070257 | ||||
chromobox homolog 6 | Cbx6 | T404 | VAAGVAGAT*GGGGGTGPSK | NP_083039 | 3.42 | |||
coiled-coil and C2 domain containing 1A | Cc2d1a | S435 | LANHDEGS*DDEEEETPK | NP_666082 | 0.08 | |||
coiled-coil and C2 domain containing 1A | Cc2d1a | S435 | LANHDEGS*DDEEEETPKK | NP_666082 | -0.09 | |||
coiled-coil domain containing 105 | Ccdc105 | Y372 | FNQEMY*VTRGIIK | NP_081906 | 9999 | |||
coiled-coil domain containing 110 | Ccdc110 | S640, S644, T647 | ERLIKAEQES*LLHS*LDT*AK | NP_001028418 | ||||
coiled-coil domain containing 12 | Ccdc12 | S165 | GQEDSLASAVDATTGQEACDS*D | NP_082588 | ||||
coiled-coil domain containing 12 | Ccdc12 | S165 | LKGQEDSLASAVDATTGQEACDS*D | NP_082588 | -0.09 | |||
coiled-coil domain containing 151 | Ccdc151 | T97, T105 | KNQDT*INQLQEET*K | NP_084215 | ||||
coiled-coil domain containing 25 | Ccdc25 | S204 | VENMSSNQDGNDS*DEFM | NP_666056 | ||||
coiled-coil domain containing 3 | Ccdc3 | S227 | S*LRQARKNSR | NP_083080 | ||||
coiled-coil domain containing 43 | Ccdc43 | T137 | AALLAQYADVT*DEEDEADKKDDAGASTANVSSDR | NP_080194 | 0.68 | -0.72 | ||
coiled-coil domain containing 43 | Ccdc43 | T137 | KAALLAQYADVT*DEEDEADKKDDAGASTANVSSDR | NP_080194 | -0.74 | |||
coiled-coil domain containing 6 | Ccdc6 | S233, S237 | LDQPVS*APPS*PR | NP_001104591 | 0.17 | -0.23 | -0.28 | |
coiled-coil domain containing 6 | Ccdc6 | S237 | LDQPVSAPPS*PR | NP_001104591 | -1.26 | |||
coiled-coil domain containing 79 | Ccdc79 | S396, T400 | DIS*EKET*LR | NP_851289 | ||||
coiled-coil domain containing 87 | Ccdc87 | T554, S555 | T*S*TPKPVPEK | NP_997151 | ||||
coiled-coil domain containing 94 | Ccdc94 | S211, S213 | LLEDS*ES*EDEAPPSRPR | NP_082657 | 0.07 | |||
coiled-coil domain containing 99 | Ccdc99 | Y279 | Y*QSLKKQNAFTR | NP_081687 | 4.99 | 4.06 | ||
coiled-coil domain containing 99 | Ccdc99 | S281 | YQS*LKKQNAFTR | NP_081687 | 5.27 | |||
chemokine (C-C motif) ligand 2 | Ccl2 | Y51 | MIPMSRLESY*KR | NP_035463 | ||||
cyclin B3 | Ccnb3 | S250, T257, T258 | KIS*LVSNVVT*T*K | NP_898836 | -6.07 | -7.12 | ||
cyclin E2 isoform 1 | Ccne2 | S337 | S*VSPVKLKTFKK | NP_001032211 | ||||
cyclin K | Ccnk | S325, S329 | KPS*PQPS*PPR | NP_033962 | 0.5 | -0.12 | ||
cyclin L1 | Ccnl1 | S358 | AEEKS*PVSINVK | NP_064321 | 0.09 | 0.28 | ||
cyclin L2 | Ccnl2 | S366 | AQGHS*PVNGLLK | NP_997561 | 1.47 | |||
cyclin fold protein 1 | Ccny | S324 | S*ASADNLILPR | NP_080760 | ||||
cyclin fold protein 1 | Ccny | S326 | SAS*ADNLILPR | NP_080760 | 0.36 | |||
cell cycle progression 1 isoform 1 | Ccpg1 | S473 | RGSRGS*HRAK | NP_001107800 | ||||
copper chaperone for superoxide dismutase | Ccs | S267 | KDS*AQPPAHL | NP_058588 | ||||
CD2-associated protein | Cd2ap | S580 | AEADDGKRNS*VDELR | NP_033977 | 0.55 | |||
CD2-associated protein | Cd2ap | S510, S514 | FNGGHS*PTQS*PEK | NP_033977 | -0.57 | |||
CD2-associated protein | Cd2ap | S510 | FNGGHS*PTQSPEK | NP_033977 | -0.98 | |||
CD2-associated protein | Cd2ap | T512 | FNGGHSPT*QSPEK | NP_033977 | ||||
CD2-associated protein | Cd2ap | S458 | S*VDLDAFVAR | NP_033977 | -2.05 | -0.22 | -0.55 | |
CD2-associated protein | Cd2ap | T231 | T*SSSETEEKKTEKPLILQPLGSR | NP_033977 | -0.36 | |||
CD2-associated protein | Cd2ap | S233 | TSS*SETEEKKTEKPLILQPLGSR | NP_033977 | -0.38 | |||
CD44 antigen isoform b | Cd44 | S448, S452 | DS*RGSS*R | NP_001034239 | 9999 | |||
cell division cycle 2 | Cdc2a | T14, Y15 | IGEGT*Y*GVVYK | NP_031685 | 0.28 | -0.21 | ||
cell division cycle 2 | Cdc2a | T14 | IGEGT*YGVVYK | NP_031685 | 0.18 | |||
cell division cycle 2 | Cdc2a | Y15 | IGEGTY*GVVYK | NP_031685 | -0.07 | 0.22 | 0.16 | |
cell division cycle 2 | Cdc2a | T161 | VYT*HEVVTLWYR | NP_031685 | 0.67 | |||
cell division cycle 2-like 1 | Cdc2l1 | T584 | AYT*PVVVTLWYR | NP_031687 | -0.68 | |||
cell division cycle 2-like 1 | Cdc2l1 | S47 | RDS*LEEGELR | NP_031687 | ||||
cell division cycle 2-like 5 (cholinesterase-related cell division controller) isoform 1 | Cdc2l5 | S664 | CLLADLPLPPELPGGDDLSKS*PEEK | NP_001074527 | -7.8 | |||
cell division cycle 2-like 5 (cholinesterase-related cell division controller) isoform 1 | Cdc2l5 | T1245 | ILELT*PEPDRPR | NP_001074527 | -0.17 | |||
CDC42 binding protein kinase beta | Cdc42bpb | S1688, S1692 | HSTPSNSSNPS*GPPS*PNSPHR | NP_898837 | ||||
CDC42 binding protein kinase beta | Cdc42bpb | S1692 | HSTPSNSSNPSGPPS*PNSPHR | NP_898837 | 0.15 | -0.08 | ||
CDC42 binding protein kinase beta | Cdc42bpb | S1695 | HSTPSNSSNPSGPPSPNS*PHR | NP_898837 | -0.09 | -0.11 | ||
CDC42 binding protein kinase beta | Cdc42bpb | S852 | SS*SLGSRTLDPLWKVR | NP_898837 | -12.69 | |||
CDC42 binding protein kinase gamma (DMPK-like) | Cdc42bpg | S1481 | SSGPQRPHS*FSEAFR | NP_001028514 | -0.57 | |||
CDC42 effector protein (Rho GTPase binding) 1 | Cdc42ep1 | S207 | RSDS*LLSFR | NP_081495 | 0.41 | |||
cell division cycle 45 homolog (S. cerevisiae)-like isoform 2 | Cdc45l | S25 | VLLFVAS*DVDALCACK | NP_001155095 | ||||
cell division cycle associated 2 | Cdca2 | S216 | RRISSQDSPDNYLS*GTK | NP_001103632 | ||||
cell division cycle associated 2 | Cdca2 | S306, T309, S315, S318 | S*PAT*PVCGSS*TPS*AKTFVLRSVLKKPGK | NP_001103632 | ||||
transcription factor RAM2 | Cdca7l | T234 | T*PPSASRRR | NP_666152 | -0.01 | |||
Cdc42 GTPase-activating protein | Cdgap | S385 | MHASSTGSS*CDLSK | NP_064656 | ||||
cyclin-dependent kinase 4 | Cdk4 | S300 | ALQHSYLHKEES*DAE | NP_034000 | -0.05 | |||
cyclin-dependent kinase inhibitor 1B | Cdkn1b | S10 | VSNGS*PSLER | NP_034005 | -0.58 | |||
cyclin-dependent kinase inhibitor 1B | Cdkn1b | S12 | VSNGSPS*LER | NP_034005 | -0.39 | -0.66 | ||
cyclin-dependent kinase inhibitor 2A isoform 1 | Cdkn2a | Y159 | WVVFVY*R | NP_034007 | -0.01 | |||
caudal type homeo box 4 | Cdx4 | T161 | T*VQVTGKTRTKEK | NP_031700 | 4.92 | |||
cadherin EGF LAG seven-pass G-type receptor 2 isoform 2 | Celsr2 | S370 | LTVEAS*DQGR | NP_001004177 | ||||
centromere protein E | Cenpe | T1970 | ETKTQKELSVT*VRTK | NP_776123 | ||||
centromere protein E | Cenpe | S751, T758 | S*LPSEVET*LRR | NP_776123 | 1.7 | |||
centrosomal protein 2 isoform 2 | Cep250 | T2318 | ET*MTSSPTQQDGRGSQR | NP_001123471 | ||||
centrosomal protein 2 isoform 2 | Cep250 | S2321 | ETMTS*SPTQQDGRGSQR | NP_001123471 | ||||
centrosomal protein 63 | Cep63 | T352, T359, S362 | LQT*TLKAVGT*QQS*VERPLEDCQK | NP_001074591 | ||||
centrin 2 | Cetn2 | S20 | RMS*PKPELTEDQKQEIR | NP_062278 | -0.28 | |||
cingulin | Cgn | S446 | HSQS*PDSGKESLLK | NP_001032800 | -0.58 | |||
cingulin | Cgn | T149 | ST*SLLELAPKPTSSINTIDTAPLSSVDSLINK | NP_001032800 | 1.13 | |||
cingulin | Cgn | S150 | STS*LLELAPKPTSSINTIDTAPLSSVDSLINK | NP_001032800 | 0.42 | |||
cingulin-like 1 | Cgnl1 | S284 | RQDS*AGPILDGAR | NP_080875 | -0.27 | 0.33 | ||
cingulin-like 1 | Cgnl1 | S298 | SS*SSSTTPTSATSLYK | NP_080875 | 0.7 | |||
cingulin-like 1 | Cgnl1 | S199, S203 | SYGS*QPNS*PTSEDLAK | NP_080875 | 0.07 | |||
chromatin assembly factor 1 subunit B | Chaf1b | T439 | TQDPSSPCT*TPSPTTQSPAPSAIK | NP_082359 | -0.94 | |||
chromodomain helicase DNA binding protein 2 | Chd2 | S1406 | ENKEKPVS*SRKDR | NP_001074814 | ||||
chromodomain helicase DNA binding protein 3 | Chd3 | S1651 | MEAEVDS*PSPAPSLGER | NP_666131 | ||||
chromodomain helicase DNA binding protein 3 | Chd3 | T1593, T1599 | TSPTT*PEASTT*NSPCTSKPATPAPSEK | NP_666131 | 0.47 | |||
chromodomain helicase DNA binding protein 3 | Chd3 | T1593, S1601 | TSPTT*PEASTTNS*PCTSKPATPAPSEK | NP_666131 | 0.47 | |||
chromodomain helicase DNA binding protein 4 | Chd4 | S1524, S1528 | KMS*QPGS*PSPK | NP_666091 | 1.54 | |||
chromodomain helicase DNA binding protein 4 | Chd4 | S1528 | MSQPGS*PSPK | NP_666091 | -0.26 | |||
SR-related CTD associated factor 6 | Cherp | S826, S828, T830 | S*RS*PT*PPSAAGLGSNSAPPIPDSR | NP_613051 | -0.13 | |||
SR-related CTD associated factor 6 | Cherp | S826, S828, S833 | S*RS*PTPPS*AAGLGSNSAPPIPDSR | NP_613051 | -0.13 | |||
chromatin modifying protein 2B | Chmp2b | S199 | ATIS*DEEIER | NP_081155 | -0.1 | |||
chromatin accessibility complex 1 | Chrac1 | S122 | REEEEDNEDDGS*DLGEALA | NP_444298 | 0.39 | |||
carbohydrate sulfotransferase 13 | Chst13 | S307 | LFQDIS*PFYQRR | NP_082204 | ||||
calcium and integrin binding family member 4 | Cib4 | S177 | SPDFMNS*FR | NP_082759 | 0.23 | |||
capicua homolog isoform b | Cic | S496 | KVFS*PVIR | NP_001103601 | -3.17 | |||
capicua homolog isoform b | Cic | S1241 | SS*PPPPLPAEERPGTK | NP_001103601 | ||||
citron | Cit | S817 | IRS*LEQR | NP_031734 | 0.74 | |||
CLIP-associating protein 1 isoform 1 | Clasp1 | S646 | RQS*SGSTTNVASTPSDSR | NP_001074745 | 1.22 | |||
CLIP-associating protein 1 isoform 1 | Clasp1 | S647 | RQSS*GSTTNVASTPSDSR | NP_001074745 | 1.49 | |||
CLIP-associating protein 1 isoform 1 | Clasp1 | T650 | RQSSGST*TNVASTPSDSR | NP_001074745 | 1.94 | |||
CLIP-associating protein 1 isoform 1 | Clasp1 | S598 | S*RSDIDVNAAASAK | NP_001074745 | 0.54 | |||
chloride channel calcium activated 3 | Clca3 | S857 | SEIS*NIAR | NP_059502 | 0 | |||
chloride channel 4 | Clcn4-2 | T584 | TLAT*DVMRPR | NP_035464 | ||||
clathrin interactor 1 | Clint1 | T308 | ASPDQNASTHT*PQSSAKPSVPSSK | NP_001038985 | -3.17 | |||
cytoplasmic linker 2 isoform b | Clip2 | S353 | KIS*GTTALQEALK | NP_001034251 | 5.65 | |||
CDC-like kinase 3 | Clk3 | S157 | YRS*PEPDPYLSYR | NP_031739 | 0.66 | |||
calmin isoform b | Clmn | S713 | S*HSEEGLDFKPSPPLSK | NP_001035772 | 0.59 | |||
calmin isoform b | Clmn | S724 | SHSEEGLDFKPS*PPLSK | NP_001035772 | -0.36 | |||
calmin isoform b | Clmn | S728 | SHSEEGLDFKPSPPLS*K | NP_001035772 | -0.36 | |||
claspin | Clspn | S1301 | LKTNGS*SPGPKR | NP_780763 | ||||
clathrin, heavy polypeptide (Hc) | Cltc | T473 | LECSEELGDLVKSVDPT*LALSVYLR | NP_001003908 | ||||
clusterin associated protein 1 | Cluap1 | S409 | KPEPLDES*DNDF | NP_084014 | 0.16 | |||
hypothetical protein LOC434903 | CN716893 | S343, S344 | DKAEAKVTLVDS*S*CK | NP_001028664 | ||||
cellular nucleic acid binding protein isoform 2 | Cnbp | T137 | CGET*GHVAINCSK | NP_001103215 | ||||
cellular nucleic acid binding protein isoform 2 | Cnbp | S115 | CYS*CGEFGHIQK | NP_001103215 | ||||
Cnksr family member 3 | Cnksr3 | S150 | APFTGITDLS*VTK | NP_766134 | 31.08 | |||
cyclin M4 | Cnnm4 | T125, T133 | GNT*SGMLVVIT*KFLR | NP_291048 | ||||
CCR4-NOT transcription complex, subunit 2 isoform a | Cnot2 | S165 | TNSMSSSGLGS*PNR | NP_001032935 | -1.05 | -0.48 | ||
contactin associated protein 1 | Cntnap1 | Y1312, S1315 | Y*KGS*YHTNEPK | NP_058062 | ||||
cordon-bleu protein | Cobl | S1128 | TPGNCEPPHS*PK | NP_766084 | -0.67 | |||
Cobl-like 1 isoform 2 | Cobll1 | S958 | ADDDIIQKPAETS*PPPVAPK | NP_081501 | 0.24 | -0.1 | ||
Cobl-like 1 isoform 2 | Cobll1 | T1021 | AET*SPPPVAAKPVALPGSQGTSLNLK | NP_081501 | -0.34 | |||
Cobl-like 1 isoform 2 | Cobll1 | S1022 | AETS*PPPVAAKPVALPGSQGTSLNLK | NP_081501 | 0.22 | -0.28 | ||
Cobl-like 1 isoform 2 | Cobll1 | S974 | AETS*PPPVFPK | NP_081501 | -0.12 | |||
Cobl-like 1 isoform 2 | Cobll1 | S923 | DPQLS*PEQHPSSLSER | NP_081501 | -0.03 | |||
Cobl-like 1 isoform 2 | Cobll1 | S268, T272 | EQTAS*APAT*PLVSK | NP_081501 | -1.47 | -2.47 | -3.1 | * |
Cobl-like 1 isoform 2 | Cobll1 | S268 | EQTAS*APATPLVSK | NP_081501 | -2.99 | -1.49 | -1.71 | * |
Cobl-like 1 isoform 2 | Cobll1 | S923 | EVQRDPQLS*PEQHPSSLSER | NP_081501 | -0.19 | |||
Cobl-like 1 isoform 2 | Cobll1 | S476, T480 | ITVEKDPDSALGIS*DGET*SPSSK | NP_081501 | -0.41 | |||
Cobl-like 1 isoform 2 | Cobll1 | S476, S481 | ITVEKDPDSALGIS*DGETS*PSSK | NP_081501 | -0.43 | |||
Cobl-like 1 isoform 2 | Cobll1 | S476 | ITVEKDPDSALGIS*DGETSPSSK | NP_081501 | -0.27 | |||
Cobl-like 1 isoform 2 | Cobll1 | S700 | LPEKEPACTYGNNVPLS*PVDGSNKNPAASYLK | NP_081501 | -0.23 | |||
Cobl-like 1 isoform 2 | Cobll1 | S1144, S1145 | QS*S*LTFQSSDPEHVR | NP_081501 | ||||
Cobl-like 1 isoform 2 | Cobll1 | S1144, T1147 | QS*SLT*FQSSDPEHVR | NP_081501 | ||||
Cobl-like 1 isoform 2 | Cobll1 | S1144 | QS*SLTFQSSDPEHVR | NP_081501 | ||||
Cobl-like 1 isoform 2 | Cobll1 | S1144 | QS*SLTFQSSDPEHVR | NP_081501 | ||||
Cobl-like 1 isoform 2 | Cobll1 | S1145 | QSS*LTFQSSDPEHVR | NP_081501 | ||||
Cobl-like 1 isoform 2 | Cobll1 | S1145 | QSS*LTFQSSDPEHVR | NP_081501 | 0.07 | 0 | ||
Cobl-like 1 isoform 2 | Cobll1 | S1144 | RQS*SLTFQSSDPEHVR | NP_081501 | -0.16 | |||
Cobl-like 1 isoform 2 | Cobll1 | S1145 | RQSS*LTFQSSDPEHVR | NP_081501 | -0.16 | |||
Cobl-like 1 isoform 2 | Cobll1 | T1147 | RQSSLT*FQSSDPEHVR | NP_081501 | -0.17 | |||
Cobl-like 1 isoform 2 | Cobll1 | T333 | ST*SVDDTDKSSSEAIMVR | NP_081501 | -0.72 | |||
Cobl-like 1 isoform 2 | Cobll1 | S334 | STS*VDDTDKSSSEAIMVR | NP_081501 | -0.3 | -0.62 | -0.55 | * |
Cobl-like 1 isoform 2 | Cobll1 | T338 | STSVDDT*DKSSSEAIMVR | NP_081501 | -0.8 | |||
Cobl-like 1 isoform 2 | Cobll1 | T350 | T*GSLQLSSTSIGTSSLK | NP_081501 | 0.69 | |||
Cobl-like 1 isoform 2 | Cobll1 | T824 | T*LSSPTGTETNPPK | NP_081501 | ||||
Cobl-like 1 isoform 2 | Cobll1 | S352 | TGS*LQLSSTSIGTSSLK | NP_081501 | 0.65 | |||
Cobl-like 1 isoform 2 | Cobll1 | S826 | TLS*SPTGTETNPPK | NP_081501 | -0.1 | -0.54 | -0.17 | |
Cobl-like 1 isoform 2 | Cobll1 | S826 | TLS*SPTGTETNPPKAPR | NP_081501 | -0.2 | |||
Cobl-like 1 isoform 2 | Cobll1 | S827 | TLSS*PTGTETNPPK | NP_081501 | -0.29 | -0.61 | ||
coilin | Coil | S174 | VTGS*PAEEDEEETK | NP_057915 | 0.15 | |||
procollagen, type IV, alpha 4 | Col4a4 | S554 | GDMVIS*RVKGQK | NP_031761 | ||||
catechol-O-methyltransferase | Comt1 | S261 | AVYQGPGSS*PVK | NP_001104532 | -0.01 | |||
catechol-O-methyltransferase | Comt1 | S261 | AVYQGPGSS*PVKS | NP_001104532 | 0.39 | -0.33 | 0.04 | |
coenzyme Q9 homolog | Coq9 | S81 | YTDQS*GEEEEDYESEEQLQHR | NP_080728 | -0.46 | |||
cytochrome c oxidase, subunit VIc | Cox6c | S2 | MS*SGALLPKPQMR | NP_444301 | ||||
copine V | Cpne5 | Y284 | GQSQFNIY*EVINPKKKMK | NP_694806 | ||||
cleavage and polyadenylation specific factor 1 | Cpsf1 | Y1032, T1036, S1037, T1038 | VY*AVAT*S*T*NTPCTRIPRMTGEEK | NP_444423 | ||||
complement receptor related protein | Cr1l | S434 | NS*LTQEVS | NP_038527 | ||||
complement receptor related protein | Cr1l | Y388, T394 | Y*KKRNTT*DEK | NP_038527 | ||||
HCF-binding transcription factor Zhangfei | Crebzf | T211 | RKSPGAGGGGANDGNQAAT*K | NP_660133 | 4.64 | |||
CREB regulated transcription coactivator 1 | Crtc1 | S151 | TNS*DSALHQSTMTPSQAESFTGGSQDAHQK | NP_001004062 | -1.37 | |||
transducer of regulated cAMP response element-binding protein (CREB) 2 | Crtc2 | T169 | T*SSDSALHTSVMNPNPQDTYPGPTPPSVLPSR | NP_083157 | -0.33 | |||
cold shock domain protein A short isoform | Csda | S290 | AGEAPTENPAPATEQSS*A | NP_035863 | ||||
cold shock domain protein A short isoform | Csda | S290 | AGEAPTENPAPATEQSS*AE | NP_035863 | ||||
cold shock domain protein A short isoform | Csda | S259 | RS*RPLNAVSQDGK | NP_035863 | 1.05 | |||
cold shock domain protein A short isoform | Csda | S33 | S*PAASGAPQAPAPAALLAGSPGGDAAPGPAPASSAPAGGEDAEK | NP_035863 | 0.14 | |||
cold shock domain protein A short isoform | Csda | S33 | S*PAASGAPQAPAPAALLAGSPGGDAAPGPAPASSAPAGGEDAEKK | NP_035863 | -0.29 | |||
cold shock domain protein A short isoform | Csda | S259 | S*RPLNAVSQDGK | NP_035863 | 1.48 | 1.42 | 2.7 | * |
cold shock domain protein A short isoform | Csda | S259 | S*RPLNAVSQDGKETK | NP_035863 | 1.91 | |||
cold shock domain protein A short isoform | Csda | S266 | SRPLNAVS*QDGK | NP_035863 | ||||
CUB and Sushi multiple domains 1 | Csmd1 | S1165 | KVYDGKDS*SSR | NP_444401 | ||||
casein alpha s2-like B | Csn1s2b | T92, Y104 | T*VMTEESKNIQDY*MNK | NP_034103 | 0.51 | |||
cysteine and glycine-rich protein 1 | Csrp1 | S192 | GFGFGQGAGALVHS*E | NP_031817 | ||||
cleavage stimulation factor subunit 3 isoform 1 | Cstf3 | S691 | RPNEDS*DEDEEKGAVVPPVHDIYR | NP_663504 | 0.34 | -0.65 | ||
CTAGE family, member 5 | Ctage5 | S512 | AFLS*PPTLLEGPLR | NP_666146 | 0.33 | |||
CCCTC-binding factor (zinc finger protein)-like | Ctcfl | T587 | T*QASEGEAGHK | NP_001074856 | ||||
catenin alpha 1 | Ctnna1 | T634 | T*PEELDDSDFETEDFDVR | NP_033948 | -0.15 | |||
catenin alpha 1 | Ctnna1 | S641 | TPEELDDS*DFETEDFDVR | NP_033948 | 0.21 | -0.13 | ||
catenin alpha 1 | Ctnna1 | S641 | TPEELDDS*DFETEDFDVRS | NP_033948 | ||||
catenin (cadherin associated protein), alpha 2 isoform 2 | Ctnna2 | S651, T653, T657 | S*RT*SVQT*EDDQLIAGQSAR | NP_001103234 | -0.01 | |||
catenin (cadherin associated protein), alpha 2 isoform 2 | Ctnna2 | S651, S654 | S*RTS*VQTEDDQLIAGQSAR | NP_001103234 | -0.03 | |||
catenin (cadherin associated protein), alpha 2 isoform 2 | Ctnna2 | T653, S654, T657 | SRT*S*VQT*EDDQLIAGQSAR | NP_001103234 | -0.39 | |||
catenin (cadherin associated protein), alpha 2 isoform 2 | Ctnna2 | T653, S654 | SRT*S*VQTEDDQLIAGQSAR | NP_001103234 | -0.03 | |||
catenin (cadherin associated protein), alpha 2 isoform 2 | Ctnna2 | T653, T657 | SRT*SVQT*EDDQLIAGQSAR | NP_001103234 | -0.03 | |||
catenin (cadherin associated protein), alpha 2 isoform 2 | Ctnna2 | T653 | SRT*SVQTEDDQLIAGQSAR | NP_001103234 | 0.01 | |||
catenin (cadherin associated protein), alpha 2 isoform 2 | Ctnna2 | S654, T657 | SRTS*VQT*EDDQLIAGQSAR | NP_001103234 | 0.04 | |||
catenin (cadherin associated protein), alpha 2 isoform 2 | Ctnna2 | S654 | SRTS*VQTEDDQLIAGQSAR | NP_001103234 | 0.22 | |||
catenin (cadherin associated protein), alpha 2 isoform 2 | Ctnna2 | T653 | T*SVQTEDDQLIAGQSAR | NP_001103234 | 0.12 | |||
catenin (cadherin associated protein), alpha 2 isoform 2 | Ctnna2 | S654 | TS*VQTEDDQLIAGQSAR | NP_001103234 | 0.06 | |||
catenin (cadherin associated protein), alpha-like 1 | Ctnnal1 | S35, T49 | S*VEQTLLPLVSQITT*LINHK | NP_061231 | 3.71 | |||
catenin (cadherin associated protein), beta 1, 88kDa | Ctnnb1 | T551 | RT*SMGGTQQQFVEGVR | NP_031640 | 1.72 | |||
catenin (cadherin associated protein), beta 1, 88kDa | Ctnnb1 | S552 | RTS*MGGTQQQFVEGVR | NP_031640 | 1.5 | |||
catenin (cadherin associated protein), beta 1, 88kDa | Ctnnb1 | T556 | RTSMGGT*QQQFVEGVR | NP_031640 | 1.77 | 1.74 | ||
catenin (cadherin associated protein), beta 1, 88kDa | Ctnnb1 | S191 | S*PQMVSAIVR | NP_031640 | 0.35 | |||
catenin (cadherin associated protein), beta 1, 88kDa | Ctnnb1 | T551 | T*SMGGTQQQFVEGVR | NP_031640 | 1.62 | 1.53 | 1.62 | * |
catenin (cadherin associated protein), beta 1, 88kDa | Ctnnb1 | S552 | TS*MGGTQQQFVEGVR | NP_031640 | 1.62 | 1.54 | 1.58 | * |
catenin, delta 1 isoform 2 | Ctnnd1 | S252 | APS*RQDVYGPQPQVR | NP_001078917 | -0.43 | -0.42 | ||
catenin, delta 1 isoform 2 | Ctnnd1 | S346, S349 | GS*LAS*LDSLRK | NP_001078917 | ||||
catenin, delta 1 isoform 2 | Ctnnd1 | S349 | GSLAS*LDSLR | NP_001078917 | 0.14 | |||
catenin, delta 1 isoform 2 | Ctnnd1 | S349 | GSLAS*LDSLRK | NP_001078917 | 0.36 | |||
catenin, delta 1 isoform 2 | Ctnnd1 | Y228 | HYEDGYPGGSDNY*GSLSR | NP_001078917 | -1.04 | |||
catenin, delta 1 isoform 2 | Ctnnd1 | S230 | HYEDGYPGGSDNYGS*LSR | NP_001078917 | 0.15 | -0.98 | ||
catenin, delta 1 isoform 2 | Ctnnd1 | S232 | HYEDGYPGGSDNYGSLS*R | NP_001078917 | -0.95 | |||
catenin, delta 1 isoform 2 | Ctnnd1 | S899 | S*GDLGDMEPLK | NP_001078917 | -0.26 | -0.19 | -0.38 | * |
catenin, delta 1 isoform 2 | Ctnnd1 | S288 | S*MGYDDLDYGMMSDYGTAR | NP_001078917 | 0.3 | |||
catenin, delta 1 isoform 2 | Ctnnd1 | S857 | SDFQVNLNNAS*R | NP_001078917 | 3.04 | |||
catenin, delta 1 isoform 2 | Ctnnd1 | S862 | SQSS*HSYDDSTLPLIDR | NP_001078917 | 1.51 | 0.66 | ||
catenin, delta 1 isoform 2 | Ctnnd1 | S864 | SQSSHS*YDDSTLPLIDR | NP_001078917 | 1.54 | 0.76 | ||
catenin, delta 1 isoform 2 | Ctnnd1 | Y865 | SQSSHSY*DDSTLPLIDR | NP_001078917 | 0.77 | |||
catenin, delta 1 isoform 2 | Ctnnd1 | T895 | T*LDRSGDLGDMEPLK | NP_001078917 | -0.28 | |||
catenin, delta 1 isoform 2 | Ctnnd1 | T140, T150 | TETT*VKKVVKTMTT*R | NP_001078917 | ||||
catenin, delta 1 isoform 2 | Ctnnd1 | S899 | TLDRS*GDLGDMEPLK | NP_001078917 | -0.02 | |||
catenin, delta 1 isoform 2 | Ctnnd1 | S268, S269 | VGGS*S*VDLHR | NP_001078917 | -0.5 | |||
catenin, delta 1 isoform 2 | Ctnnd1 | S268 | VGGS*SVDLHR | NP_001078917 | 0.37 | 0.31 | -0.4 | |
catenin, delta 1 isoform 2 | Ctnnd1 | S269 | VGGSS*VDLHR | NP_001078917 | 0.41 | 0.17 | ||
catenin (cadherin associated protein), delta 2 | Ctnnd2 | S1093, S1097 | SAS*APAS*PR | NP_032755 | 43.72 | |||
SH2 domain binding protein 1 (tetratricopeptide repeat containing) | Ctr9 | S970 | GEEGS*EEEETENGPKPK | NP_033457 | -0.24 | |||
SH2 domain binding protein 1 (tetratricopeptide repeat containing) | Ctr9 | T925 | GGEFDEFVNDDT*DDDLPVSK | NP_033457 | -0.02 | |||
SH2 domain binding protein 1 (tetratricopeptide repeat containing) | Ctr9 | T925 | KGGEFDEFVNDDT*DDDLPVSK | NP_033457 | 0.46 | -0.21 | ||
SH2 domain binding protein 1 (tetratricopeptide repeat containing) | Ctr9 | S970 | RPPKGEEGS*EEEETENGPKPK | NP_033457 | 0.16 | -0.2 | ||
cortactin | Cttn | S150 | HAS*QKDYSSGFGGKYGVQADR | NP_031829 | 6.54 | |||
cortactin | Cttn | T401, S405, S418 | KQT*PPAS*PSPQPIEDRPPSS*PIYEDAAPFK | NP_031829 | -0.81 | |||
cortactin | Cttn | T401, S405 | KQT*PPAS*PSPQPIEDRPPSSPIYEDAAPFK | NP_031829 | -0.04 | |||
cortactin | Cttn | T401, S407, S418 | KQT*PPASPS*PQPIEDRPPSS*PIYEDAAPFK | NP_031829 | -0.81 | |||
cortactin | Cttn | T401, S407 | KQT*PPASPS*PQPIEDRPPSSPIYEDAAPFK | NP_031829 | 0.47 | -0.04 | ||
cortactin | Cttn | T401, S417 | KQT*PPASPSPQPIEDRPPS*SPIYEDAAPFK | NP_031829 | -0.31 | |||
cortactin | Cttn | T401, S418 | KQT*PPASPSPQPIEDRPPSS*PIYEDAAPFK | NP_031829 | 0.66 | -0.19 | ||
cortactin | Cttn | T401 | KQT*PPASPSPQPIEDRPPSSPIYEDAAPFK | NP_031829 | 1.31 | -0.36 | ||
cortactin | Cttn | S418 | KQTPPASPSPQPIEDRPPSS*PIYEDAAPFK | NP_031829 | -0.29 | |||
cortactin | Cttn | S417 | QTPPASPSPQPIEDRPPS*SPIYEDAAPFK | NP_031829 | -0.41 | |||
cortactin | Cttn | S418 | QTPPASPSPQPIEDRPPSS*PIYEDAAPFK | NP_031829 | -0.41 | |||
cortactin | Cttn | Y421 | QTPPASPSPQPIEDRPPSSPIY*EDAAPFK | NP_031829 | -0.43 | |||
CTTNBP2 N-terminal like | Cttnbp2nl | S488 | DLS*PTLLDNSAAK | NP_001156804 | -0.78 | |||
cullin 5 isoform 2 | Cul5 | T285 | AYLDST*ER | NP_001155090 | <-10 | |||
cut-like homeobox 1 isoform a | Cux1 | S1417 | AAS*REEPIEWEF | NP_034116 | -1.16 | |||
coxsackievirus and adenovirus receptor isoform a | Cxadr | S332 | APQS*PTLAPAK | NP_001020363 | -1.1 | -1.84 | -1.98 | * |
cytochrome b5 type B precursor | Cyb5b | S33 | RNS*AEETWMVIHGR | NP_079834 | 0.3 | |||
cytochrome P450, family 19, subfamily a, polypeptide 1 | Cyp19a1 | T392 | KGT*NIILNIGR | NP_031836 | 2.05 | |||
cytochrome P450, family 21, subfamily a, polypeptide 1 | Cyp21a1 | S120, S122 | LS*RS*ALMLGMR | NP_034125 | ||||
cytochrome P450, family 46, subfamily a, polypeptide 1 | Cyp46a1 | S146 | QRKVMDLAFS*R | NP_034140 | ||||
cytospin B | Cytsb | S52 | LGS*SPTSSCNPTPTK | NP_001025107 | -0.31 | |||
cytospin B | Cytsb | S53 | LGSS*PTSSCNPTPTK | NP_001025107 | 0.12 | |||
hypothetical protein LOC28081 | D11Wsu99e | S62, S64 | RS*PS*PAAMSER | NP_613064 | -0.59 | |||
hypothetical protein LOC210998 | D15Ertd621e | Y64 | YY*EELLK | NP_666071 | ||||
PREDICTED: hypothetical protein | D630015H07 | S42 | MTTKGS*LPERK | XP_001479168 | 11.48 | |||
hypothetical protein LOC28006 | D6Wsu116e | S388 | ARPAQAPVSEELPPS*PKPGK | NP_080861 | -0.86 | |||
hypothetical protein LOC28006 | D6Wsu116e | S533 | GLFS*DEEDSEDLFSSQSSSKPK | NP_080861 | 0.05 | |||
hypothetical protein LOC28006 | D6Wsu116e | S723 | VPLLFS*DEEDSEVPSGVKPEDLK | NP_080861 | -0.12 | |||
hypothetical protein LOC28006 | D6Wsu116e | S747 | VS*PEVGSADVASIAQK | NP_080861 | 0.05 | |||
hypothetical protein LOC242474 | D730040F13Rik | S12 | GGPAEAPS*PR | NP_780727 | 0.81 | |||
death-associated protein | Dap | S49 | DKDDQEWES*TSPPKPTVFISGVIAR | NP_666169 | 0.25 | |||
death-associated protein | Dap | T50 | DKDDQEWEST*SPPKPTVFISGVIAR | NP_666169 | -0.52 | |||
death-associated protein | Dap | S51 | DKDDQEWESTS*PPKPTVF | NP_666169 | -0.02 | 0.28 | 0.3 | |
death-associated protein | Dap | S51 | DKDDQEWESTS*PPKPTVFISGVIAR | NP_666169 | 0.9 | 0.25 | ||
death-associated protein | Dap | T56 | DKDDQEWESTSPPKPT*VF | NP_666169 | ||||
diazepam binding inhibitor isoform 1 | Dbi | T84 | QAT*VGDVNTDRPGLLDLK | NP_001033088 | ||||
drebrin 1 | Dbn1 | S142 | LSS*PVLHR | NP_062787 | 0.02 | 0.29 | ||
SCF apoptosis response protein 1 | Dbndd2 | S142 | SPNPSDGGGDTPLAQS*DEEDGDDGGAEPGPCS | NP_001041692 | ||||
SCF apoptosis response protein 1 | Dbndd2 | S117 | TSS*LSSDSSNLR | NP_001041692 | -1.26 | |||
drebrin-like isoform 1 | Dbnl | S277 | AMS*TTSVTSSQPGK | NP_001139780 | -0.66 | -0.36 | -0.11 | |
drebrin-like isoform 1 | Dbnl | T278 | AMST*TSVTSSQPGK | NP_001139780 | -0.11 | -0.14 | ||
drebrin-like isoform 1 | Dbnl | S280 | AMSTTS*VTSSQPGK | NP_001139780 | ||||
drebrin-like isoform 1 | Dbnl | S291 | LRS*PFLQK | NP_001139780 | -1.91 | -1.55 | ||
drebrin-like isoform 1 | Dbnl | T299 | QLT*QPETSYGR | NP_001139780 | ||||
drebrin-like isoform 1 | Dbnl | T299 | QLT*QPETSYGR | NP_001139780 | -0.01 | |||
debranching enzyme homolog 1 | Dbr1 | S520 | RLS*DEHEPEQR | NP_113580 | 0.52 | |||
deoxycytidine kinase | Dck | S11 | FCPS*PSTSSEGTR | NP_031858 | 0.12 | 0.2 | 0.54 | |
deoxycytidine kinase | Dck | S13 | FCPSPS*TSSEGTR | NP_031858 | -0.21 | |||
doublecortin-like kinase 2 | Dclk2 | S333 | S*TKSSSSSPTSPGSFR | NP_081815 | 9.69 | |||
doublecortin-like kinase 2 | Dclk2 | S295, S298 | VLKSSYS*RAS*AAK | NP_081815 | ||||
doublecortin isoform a | Dcx | S165, S167 | TSANMKAPQSLASS*NS*AQARENK | NP_001103692 | >10 | |||
DEAD (Asp-Glu-Ala-Asp) box polypeptide 10 | Ddx10 | T587 | LASGDGDEEQDEET*EDEETEDHLGK | NP_084212 | 0.34 | |||
DEAD box polypeptide 17 isoform 4 | Ddx17 | S374 | S*QPERDWVLNEFR | NP_001035277 | 1.34 | |||
DEAD (Asp-Glu-Ala-Asp) box polypeptide 24 isoform 1 | Ddx24 | S114, T117 | LVKNPSRLFSS*EET*KK | NP_001152974 | ||||
DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, Y-linked | Ddx3y | S603 | QS*SGSANAGFNSNR | NP_036138 | ||||
DEAD (Asp-Glu-Ala-Asp) box polypeptide 42 | Ddx42 | S821 | GGSRHS*HGDGGNR | NP_082350 | ||||
DEAD (Asp-Glu-Ala-Asp) box polypeptide 51 | Ddx51 | S77 | RVS*GSATPNSEAPR | NP_081432 | -0.1 | 0.38 | ||
DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 | Ddx54 | S774 | IDDRDS*EEEGPSNQR | NP_082317 | -0.01 | |||
DEAD (Asp-Glu-Ala-Asp) box polypeptide 60 | Ddx60 | S212, Y220 | RMIMIVYKS*LIQQLEKY*R | NP_001074684 | ||||
differentially expressed in FDCP 6 | Def6 | Y222 | QGY*LWKRGHLR | NP_081461 | ||||
DEK oncogene | Dek | S33 | EES*EEEEEDDEDDDEEDEEEEKEK | NP_080176 | 0.3 | -0.36 | ||
DENN/MADD domain containing 4C | Dennd4c | S1145 | THS*FENVNCHLADSR | NP_001074483 | -0.14 | |||
DNA fragmentation factor, alpha subunit isoform a | Dffa | S314 | RS*PLPGEPQRPK | NP_001020467 | -0.39 | |||
diacylglycerol kinase, theta | Dgkq | S22, S26 | LGS*PAGS*PVLGISGR | NP_950176 | ||||
DEAH (Asp-Glu-Ala-Asp/His) box polypeptide 57 homolog | Dhx57 | S625 | TEES*DFLLLVLK | NP_945180 | 0.15 | |||
DIS3 mitotic control homolog (S. cerevisiae)-like 2 | Dis3l2 | S864 | RPGLEKAS*DEEPED | NP_705758 | 0.12 | |||
dyskerin | Dkc1 | S508 | VKVVEEMS*E | NP_001025478 | 0.16 | |||
dyskerin | Dkc1 | S508 | VVEEMS*E | NP_001025478 | ||||
discs large homolog 1 | Dlg1 | S710 | DQSEQETSDADQHVTSNAS*DSESSYR | NP_031888 | -0.79 | |||
discs large homolog 1 | Dlg1 | S573 | EQMMNSSVSSGS*GSLR | NP_031888 | -0.7 | |||
discs large homolog 1 | Dlg1 | S575 | EQMMNSSVSSGSGS*LR | NP_031888 | -0.59 | -0.52 | ||
discs large homolog 1 | Dlg1 | S710 | HVTSNAS*DSESSYR | NP_031888 | -0.09 | -0.16 | ||
discs large homolog 5 isoform 1 | Dlg5 | S1254 | ASQGSNS*LPSSAR | NP_001156985 | -0.21 | |||
discs large homolog-associated protein 1 isoform 4 | Dlgap1 | T223, S226, S227 | T*IQS*S*TGVIK | NP_001121653 | ||||
PREDICTED: similar to SI:zC220F6.1 (novel protein similar to human dynein heavy chain (DHC)) | Dnahc6 | S3071, S3082, Y3086 | EVLDPALEPILLKQTFMS*GGRLLIHLGDS*DIDY*DK | XP_001478071 | ||||
DnaJ (Hsp40) homolog, subfamily C, member 5 | Dnajc5 | S8 | S*LSTSGESLYHVLGLDK | NP_058055 | 0.92 | 0.23 | ||
DnaJ (Hsp40) homolog, subfamily C, member 5 | Dnajc5 | S10 | SLS*TSGESLYHVLGLDK | NP_058055 | 0.92 | |||
DnaJ (Hsp40) homolog, subfamily C, member 5 | Dnajc5 | T11 | SLST*SGESLYHVLGLDK | NP_058055 | ||||
dynamin 1-like isoform b | Dnm1l | S579 | SKPIPIMPAS*PQK | NP_001021118 | -0.43 | -0.53 | ||
dynamin 3 isoform 1 | Dnm3 | S763, S767 | S*PPPS*PTTQR | NP_001033708 | -0.42 | |||
DNA methyltransferase 3A isoform 1 | Dnmt3a | S102 | SEPQPEEGS*PAAGQK | NP_031898 | -0.09 | 0.22 | ||
DNA methyltransferase 3B isoform 2 | Dnmt3b | S401 | DRGEDEES*R | NP_001003960 | ||||
terminal deoxynucleotidyltransferase interacting factor 1 | Dnttip1 | S160 | QAEEESHRGS*PIPK | NP_598524 | 0.37 | |||
dedicator of cytokinesis 1 | Dock1 | T1857 | KQT*SVDSGIVQ | NP_001028592 | -0.32 | |||
dedicator of cytokinesis 1 | Dock1 | S1858 | KQTS*VDSGIVQ | NP_001028592 | -0.56 | -0.34 | 0.03 | |
dedicator of cytokinesis 1 | Dock1 | T542 | YDGT*TLR | NP_001028592 | ||||
dedicator of cytokinesis 8 | Dock8 | S903 | VMS*SSNPDLTGSHCAADEEVK | NP_083061 | 0.02 | |||
dedicator of cytokinesis 8 | Dock8 | S905 | VMSSS*NPDLTGSHCAADEEVK | NP_083061 | 0 | |||
pad-1-like isoform 1 | Dopey2 | Y836 | Y*KTSGNNPFFGK | NP_081569 | ||||
DOT1-like, histone H3 methyltransferase | Dot1l | S373 | AAATEAPADS*GAEEEK | NP_955354 | 0.03 | |||
DOT1-like, histone H3 methyltransferase | Dot1l | S897, S900 | AERARS*TPS*PVPQPR | NP_955354 | ||||
DOT1-like, histone H3 methyltransferase | Dot1l | T898, S900 | AERARST*PS*PVPQPR | NP_955354 | -9999 | |||
diffuse panbronchiolitis critical region 1 | Dpcr1 | S210, S211, T226 | QS*S*SPVYATETPRTSYNT*LK | NP_001028538 | ||||
developmental pluripotency associated 5A | Dppa5a | S31 | VPEDLKDPEVFQVQS*LVLKYLFGPQGSR | NP_079550 | -6.56 | |||
dihydropyrimidinase-like 2 | Dpysl2 | T509 | GLYDGPVCEVSVT*PK | NP_034085 | -0.77 | |||
dihydropyrimidinase-like 2 | Dpysl2 | S522 | TS*PAKQQAPPVR | NP_034085 | 0.95 | |||
Down syndrome cell adhesion molecule | Dscam | S1809, Y1811 | ARSSMVSTESASS*TY*EELARAYEHAK | NP_112451 | ||||
desmoplakin | Dsp | S22 | AES*GPDLR | NP_076331 | -0.92 | |||
desmoplakin | Dsp | S2832, S2836 | GLPSPYNMS*APGS*R | NP_076331 | -0.4 | |||
desmoplakin | Dsp | S2618 | S*SSLSDPLEESSPIAAIFDTENLEK | NP_076331 | -0.67 | |||
desmoplakin | Dsp | S2221 | SMS*FQGIR | NP_076331 | -0.31 | |||
desmoplakin | Dsp | S2622 | SSSLS*DPLEESSPIAAIFDTENLEK | NP_076331 | -1.02 | |||
dystonin isoform a | Dst | S3621, T3623, T3625 | LVS*DT*IT*QK | NP_598594 | ||||
denticleless homolog | Dtl | S509, T515 | TPS*SSPPVT*PPASETK | NP_084042 | -0.23 | |||
dynein cytoplasmic 1 intermediate chain 2 | Dync1i2 | S83 | EAEALLQSMGLTTDSPIVPPPMSPS*SK | NP_034194 | -0.74 | |||
dynein cytoplasmic 1 light intermediate chain 1 | Dync1li1 | S510, T515 | KPASVS*PTTPT*SPTEGEAS | NP_666341 | -0.16 | |||
dynein cytoplasmic 1 light intermediate chain 1 | Dync1li1 | S510, S516 | KPASVS*PTTPTS*PTEGEAS | NP_666341 | -0.16 | |||
dynein cytoplasmic 1 light intermediate chain 1 | Dync1li1 | S510 | KPASVS*PTTPTSPTEGEAS | NP_666341 | 0.02 | -0.25 | ||
dynein cytoplasmic 1 light intermediate chain 1 | Dync1li1 | T512, T515 | KPASVSPT*TPT*SPTEGEAS | NP_666341 | 0.1 | |||
dynein cytoplasmic 1 light intermediate chain 1 | Dync1li1 | T515 | KPASVSPTTPT*SPTEGEAS | NP_666341 | -0.39 | -0.36 | ||
dynein cytoplasmic 1 light intermediate chain 1 | Dync1li1 | S516 | KPASVSPTTPTS*PTEGEAS | NP_666341 | -0.42 | -0.36 | ||
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1b isoform b | Dyrk1b | Y273 | IYQY*IQSR | NP_001033046 | -0.17 | 0.06 | 0.08 | |
DAZ interacting protein 3, zinc finger isoform 1 | Dzip3 | S796, S809 | EKIIVS*LNQQVAFGINKMS*K | NP_001103487 | ||||
PREDICTED: similar to ciliary rootlet coiled-coil, rootletin | E030010N08Rik | T546 | EAETQKLEVT*NAELR | XP_001474905 | ||||
PREDICTED: similar to ciliary rootlet coiled-coil, rootletin | E030010N08Rik | T1605, T1614 | T*RLIQTEQET*LRK | XP_982250 | ||||
hypothetical protein LOC268739 isoform 2 | E130112L23Rik | S959 | IQQQLGEEAS*PR | NP_001139393 | -0.13 | -1.1 | -14.44 | |
hypothetical protein LOC230098 | E130306D19Rik | T26 | WERKRVCT*AR | NP_001013395 | ||||
E2F transcription factor 7 | E2f7 | T42 | MT*PKTPMK | NP_848724 | ||||
hypothetical protein LOC214763 | E330016A19Rik | T170 | KDISEAAET*VNK | NP_775562 | ||||
ELL associated factor 1 | Eaf1 | T157, S165 | T*SPLKDNPS*PEPQLDDIKR | NP_083208 | -0.2 | |||
ELL associated factor 1 | Eaf1 | S158, S165 | TS*PLKDNPS*PEPQLDDIKR | NP_083208 | 0.08 | |||
estrogen receptor-binding fragment-associated gene 9 | Ebag9 | S36 | KLS*GDQITLPTTVDYSSVPK | NP_062353 | 0.55 | -0.18 | ||
cDNA sequence BC022641 | Edc4 | T863 | DSQDT*SAEQSDHDDEVASLASASGGFGSK | NP_853625 | -0.06 | -0.33 | ||
cDNA sequence BC022641 | Edc4 | S864 | DSQDTS*AEQSDHDDEVASLASASGGFGSK | NP_853625 | 0.04 | 0.01 | ||
cDNA sequence BC022641 | Edc4 | S868 | DSQDTSAEQS*DHDDEVASLASASGGFGSK | NP_853625 | 0.23 | -0.33 | ||
cDNA sequence BC022641 | Edc4 | T731 | T*RSPDVISSASTALSQDIPEIASEALSR | NP_853625 | 0.55 | |||
cDNA sequence BC022641 | Edc4 | S733 | TRS*PDVISSASTALSQDIPEIASEALSR | NP_853625 | 0.52 | |||
eukaryotic translation elongation factor 1 beta 2 | Eef1b2 | S106 | DDDDIDLFGS*DDEEESEEAKK | NP_061266 | -0.01 | |||
eukaryotic translation elongation factor 1 beta 2 | Eef1b2 | S106 | YGPSSVEDTTGSGAADAKDDDDIDLFGS*DDEEESEEAK | NP_061266 | -0.17 | |||
eukaryotic translation elongation factor 1 beta 2 | Eef1b2 | S106 | YGPSSVEDTTGSGAADAKDDDDIDLFGS*DDEEESEEAKK | NP_061266 | 0.76 | -0.54 | ||
eukaryotic translation elongation factor 1 delta isoform b | Eef1d | T129 | ATAPQT*QHVSPMR | NP_075729 | -0.24 | |||
eukaryotic translation elongation factor 1 delta isoform b | Eef1d | S133 | ATAPQTQHVS*PMR | NP_075729 | -0.14 | -0.21 | -0.01 | |
eukaryotic translation elongation factor 1 delta isoform b | Eef1d | S162 | GATPAEDDEDKDIDLFGS*DEEEEDKEAAR | NP_075729 | 0.5 | -0.43 | -0.49 | |
eukaryotic translation elongation factor 1 delta isoform b | Eef1d | S162 | KGATPAEDDEDKDIDLFGS*DEEEEDKEAAR | NP_075729 | 0.81 | -0.4 | ||
EF hand domain containing 2 | Efhd2 | S74 | ADLNQGIGEPQS*PSR | NP_080270 | -1.86 | |||
EF hand domain containing 2 | Efhd2 | S74 | RADLNQGIGEPQS*PSR | NP_080270 | -0.82 | |||
PREDICTED: hypothetical protein | EG240921 | S457, S462, S464 | S*FPAMS*LS*PATPPKKPR | XP_136331 | ||||
PREDICTED: similar to P300/CBP-associated factor | EG330129 | T706, S711 | ET*GWKPS*R | XP_284106 | ||||
PREDICTED: hypothetical protein isoform 1 | EG433283 | T148, T150 | T*RT*LLVGER | XP_484844 | ||||
PREDICTED: similar to glyceraldehyde-3-phosphate-dehydrogenase isoform 1 | EG545741 | S210, T211 | GAAQNIIPAS*T*GTAK | XP_001487831 | ||||
PREDICTED: similar to glyceraldehyde-3-phosphate-dehydrogenase isoform 1 | EG545741 | T211, T213 | GAAQNIIPAST*GT*AK | XP_001487831 | ||||
PREDICTED: similar to conserved nuclear protein Nhn1 isoform 1 | EG546337 | S613 | SRSRSFSSPSPS*PTPSPHRPPVRTK | XP_621046 | ||||
PREDICTED: similar to ubiquitin-conjugating enzyme E2 UbcH-ben | EG546362 | S30 | LLAEPVPGIKAEPDES*KAR | XP_621074 | ||||
PREDICTED: hypothetical protein isoform 1 | EG622236 | T33, S39 | NIDDGT*LDRPYS*HALVAGIDR | XP_894897 | ||||
PREDICTED: hypothetical protein | EG622446 | S2, T8 | MS*DAAVDT*NSEITTK | XP_902195 | ||||
PREDICTED: similar to Lage3 protein | EG626952 | S35, S51 | AVIPS*GAHPVGRALEASRNPS*K | XP_896668 | ||||
PREDICTED: hypothetical protein | EG638833 | S164, S167 | AS*NAS*CTTNCLAPLAK | XP_920080 | ||||
PREDICTED: hypothetical protein | EG638833 | S164, S167 | AS*NAS*CTTNCLAPLAK | XP_920080 | ||||
PREDICTED: hypothetical protein | EG638833 | S164, S167 | AS*NAS*CTTNCLAPLAK | XP_920080 | ||||
PREDICTED: hypothetical protein | EG638833 | S141 | VIISAPS*ADTPMFVMGVNQKK | XP_920080 | ||||
PREDICTED: similar to Murinoglobulin 1 | EG640530 | T646 | HT*NSVPHGR | XP_001480324 | >10 | |||
PREDICTED: similar to calmodulin | EG640703 | S59 | SRVS*NPAPRR | XP_922860 | ||||
PREDICTED: similar to EG635895 protein | EG665669 | S470, S474 | S*VWPS*SIGQVPAYGQK | XP_001478598 | 0.1 | |||
PREDICTED: hypothetical protein isoform 2 | EG666747 | T165 | ERRTT*LWWLK | XP_001000540 | ||||
PREDICTED: hypothetical protein | EG668548 | S109, S110 | HTGPGILSMANAGPNTNS*S*QFFICTAK | XP_001002180 | ||||
eukaryotic translation initiation factor 2B, subunit 5 epsilon | Eif2b5 | S540 | AGS*PQLDDIR | NP_758469 | -0.26 | 0.05 | 0.1 | |
eukaryotic translation initiation factor 3, subunit 10 (theta) | Eif3a | S1149 | AREES*WGPPR | NP_034253 | ||||
eukaryotic translation initiation factor 3, subunit 9 | Eif3b | S68, T74, S79 | AKPAAQS*EEETAT*SPAAS*PTPQSAER | NP_598677 | ||||
eukaryotic translation initiation factor 3, subunit 9 | Eif3b | S68, S75, S79 | AKPAAQS*EEETATS*PAAS*PTPQSAER | NP_598677 | -0.1 | |||
eukaryotic translation initiation factor 3, subunit 9 | Eif3b | S68, S75, T81 | AKPAAQS*EEETATS*PAASPT*PQSAER | NP_598677 | -0.09 | |||
eukaryotic translation initiation factor 3, subunit 9 | Eif3b | S68, S75 | AKPAAQS*EEETATS*PAASPTPQSAER | NP_598677 | 0.76 | -0.24 | ||
eukaryotic translation initiation factor 3, subunit 9 | Eif3b | S68, S79 | AKPAAQS*EEETATSPAAS*PTPQSAER | NP_598677 | -0.19 | |||
eukaryotic translation initiation factor 3, subunit 9 | Eif3b | T72, S75, S79 | AKPAAQSEEET*ATS*PAAS*PTPQSAER | NP_598677 | ||||
eukaryotic translation initiation factor 3, subunit 9 | Eif3b | T72, S75 | AKPAAQSEEET*ATS*PAASPTPQSAER | NP_598677 | -0.16 | |||
eukaryotic translation initiation factor 3, subunit 9 | Eif3b | T74, S75, S79 | AKPAAQSEEETAT*S*PAAS*PTPQSAER | NP_598677 | -0.36 | |||
eukaryotic translation initiation factor 3, subunit 9 | Eif3b | T74, S79 | AKPAAQSEEETAT*SPAAS*PTPQSAER | NP_598677 | 0.03 | |||
eukaryotic translation initiation factor 3, subunit 9 | Eif3b | S75, S79 | AKPAAQSEEETATS*PAAS*PTPQSAER | NP_598677 | 0.32 | -0.18 | -0.31 | |
eukaryotic translation initiation factor 3, subunit 9 | Eif3b | S75, T81 | AKPAAQSEEETATS*PAASPT*PQSAER | NP_598677 | 0.17 | 0.56 | ||
eukaryotic translation initiation factor 3, subunit 9 | Eif3b | S75 | AKPAAQSEEETATS*PAASPTPQSAER | NP_598677 | 0.15 | -0.28 | ||
eukaryotic translation initiation factor 3, subunit 9 | Eif3b | S120, S123 | GHPSAGAEEEGGS*DGS*AAEAEPR | NP_598677 | 0.36 | |||
eukaryotic translation initiation factor 3, subunit 9 | Eif3b | S120 | GHPSAGAEEEGGS*DGSAAEAEPR | NP_598677 | ||||
eukaryotic translation initiation factor 3, subunit 9 | Eif3b | S120 | GHPSAGAEEEGGS*DGSAAEAEPR | NP_598677 | -0.25 | 0.25 | ||
eukaryotic translation initiation factor 3, subunit 9 | Eif3b | S123 | GHPSAGAEEEGGSDGS*AAEAEPR | NP_598677 | ||||
eukaryotic translation initiation factor 3, subunit 9 | Eif3b | S88 | S*PSQEPSAPGK | NP_598677 | 0.59 | |||
eukaryotic translation initiation factor 3, subunit 9 | Eif3b | S90 | SPS*QEPSAPGK | NP_598677 | 0.62 | |||
eukaryotic translation initiation factor 3, subunit C | Eif3c | S39 | QPLLLS*EDEEDTKR | NP_666312 | -0.05 | |||
eukaryotic translation initiation factor 3, subunit G | Eif3g | T38 | GIPLPT*GDTSPEPELLPGDPLPPPK | NP_058572 | 0.17 | |||
eukaryotic translation initiation factor 3, subunit G | Eif3g | T41 | GIPLPTGDT*SPEPELLPGDPLPPPK | NP_058572 | -0.02 | |||
eukaryotic translation initiation factor 3, subunit G | Eif3g | S42 | GIPLPTGDTS*PEPELLPGDPLPPPK | NP_058572 | 0.17 | -0.27 | ||
eukaryotic translation initiation factor 3 subunit 6 interacting protein | Eif3l | Y58 | NFIQY*FHK | NP_660121 | ||||
eukaryotic translation initiation factor 4B | Eif4b | S283 | AFGS*GYR | NP_663600 | -2.38 | -0.01 | ||
eukaryotic translation initiation factor 4B | Eif4b | T204 | ARPT*TDSFDDYPPR | NP_663600 | 0.2 | |||
eukaryotic translation initiation factor 4B | Eif4b | T205 | ARPTT*DSFDDYPPR | NP_663600 | 0.21 | |||
eukaryotic translation initiation factor 4B | Eif4b | S207 | ARPTTDS*FDDYPPR | NP_663600 | 0.05 | |||
eukaryotic translation initiation factor 4B | Eif4b | S459 | EEDCHS*PTSKPPKPDQPLK | NP_663600 | -0.19 | |||
eukaryotic translation initiation factor 4B | Eif4b | S495 | S*QSSDTEQPSPTSGGGK | NP_663600 | -1 | |||
eukaryotic translation initiation factor 4B | Eif4b | S459 | SLENETLNKEEDCHS*PTSKPPKPDQPLK | NP_663600 | -1.22 | |||
eukaryotic translation initiation factor 4B | Eif4b | T461 | SLENETLNKEEDCHSPT*SKPPKPDQPLK | NP_663600 | -0.28 | -1.33 | ||
eukaryotic translation initiation factor 4B | Eif4b | S497 | SQS*SDTEQPSPTSGGGK | NP_663600 | -0.47 | |||
eukaryotic translation initiation factor 4B | Eif4b | S498 | SQSS*DTEQPSPTSGGGK | NP_663600 | -0.47 | |||
eukaryotic translation initiation factor 4B | Eif4b | S504 | SQSSDTEQPS*PTSGGGK | NP_663600 | 0.31 | |||
eukaryotic translation initiation factor 4B | Eif4b | T420, S425 | T*GSESS*QTGASATSGR | NP_663600 | 1.2 | |||
eukaryotic translation initiation factor 4B | Eif4b | T420 | T*GSESSQTGASATSGR | NP_663600 | 0.01 | |||
eukaryotic translation initiation factor 4B | Eif4b | S422, S425 | TGS*ESS*QTGASATSGR | NP_663600 | 1.22 | |||
eukaryotic translation initiation factor 4B | Eif4b | S422 | TGS*ESSQTGASATSGR | NP_663600 | 0.01 | |||
eukaryotic translation initiation factor 4B | Eif4b | S597 | YAALS*VDGEDEDEGDDCTE | NP_663600 | ||||
eukaryotic translation initiation factor 4E binding protein 1 | Eif4ebp1 | T69, S99 | T*PPKDLPAIPGVTSPTSDEPPMQASQSQLPS*SPEDKR | NP_031944 | 0.3 | |||
eukaryotic translation initiation factor 4E binding protein 1 | Eif4ebp1 | T69 | T*PPKDLPAIPGVTSPTSDEPPMQASQSQLPSSPEDK | NP_031944 | 0.59 | |||
eukaryotic translation initiation factor 4E binding protein 1 | Eif4ebp1 | T69 | T*PPKDLPAIPGVTSPTSDEPPMQASQSQLPSSPEDKR | NP_031944 | 0.94 | |||
eukaryotic translation initiation factor 4E binding protein 1 | Eif4ebp1 | S85 | TPPKDLPAIPGVTSPTS*DEPPMQASQSQLPSSPEDKR | NP_031944 | 0.19 | |||
eukaryotic translation initiation factor 4E binding protein 1 | Eif4ebp1 | T35, T45 | VALGDGVQLPPGDYST*TPGGTLFSTT*PGGTR | NP_031944 | -0.08 | |||
eukaryotic translation initiation factor 4E binding protein 1 | Eif4ebp1 | T36, S43 | VALGDGVQLPPGDYSTT*PGGTLFS*TTPGGTR | NP_031944 | 0.34 | |||
eukaryotic translation initiation factor 4E binding protein 1 | Eif4ebp1 | T36, T45 | VALGDGVQLPPGDYSTT*PGGTLFSTT*PGGTR | NP_031944 | 0.15 | |||
eukaryotic translation initiation factor 4E binding protein 1 | Eif4ebp1 | T36, T49 | VALGDGVQLPPGDYSTT*PGGTLFSTTPGGT*R | NP_031944 | 0.2 | |||
eukaryotic translation initiation factor 4E binding protein 1 | Eif4ebp1 | T40, T45 | VALGDGVQLPPGDYSTTPGGT*LFSTT*PGGTR | NP_031944 | 0.87 | |||
eukaryotic translation initiation factor 4E binding protein 1 | Eif4ebp1 | T40, T49 | VALGDGVQLPPGDYSTTPGGT*LFSTTPGGT*R | NP_031944 | -0.17 | |||
eukaryotic translation initiation factor 4E binding protein 1 | Eif4ebp1 | S43, T45 | VALGDGVQLPPGDYSTTPGGTLFS*TT*PGGTR | NP_031944 | 0.36 | |||
eukaryotic translation initiation factor 4E binding protein 2 | Eif4ebp2 | T70 | NSPMAQT*PPCHLPNIPGVTSPGALIEDSK | NP_034254 | 1.47 | |||
eukaryotic translation initiation factor 4E binding protein 2 | Eif4ebp2 | S65 | RNS*PMAQTPPCHLPNIPGVTSPGALIEDSK | NP_034254 | 0.59 | |||
eukaryotic translation initiation factor 4E binding protein 2 | Eif4ebp2 | T36, T46 | TVAISDAAQLPQDYCT*TPGGTLFSTT*PGGTR | NP_034254 | 0.9 | |||
eukaryotic translation initiation factor 4E binding protein 2 | Eif4ebp2 | T37, S44 | TVAISDAAQLPQDYCTT*PGGTLFS*TTPGGTR | NP_034254 | 0.12 | |||
eukaryotic translation initiation factor 4E binding protein 2 | Eif4ebp2 | T37, T46 | TVAISDAAQLPQDYCTT*PGGTLFSTT*PGGTR | NP_034254 | 0.87 | -0.08 | -0.16 | |
eukaryotic translation initiation factor 4E binding protein 2 | Eif4ebp2 | T37, T50 | TVAISDAAQLPQDYCTT*PGGTLFSTTPGGT*R | NP_034254 | 0.16 | |||
eukaryotic translation initiation factor 4E binding protein 2 | Eif4ebp2 | T41, T46 | TVAISDAAQLPQDYCTTPGGT*LFSTT*PGGTR | NP_034254 | 0.4 | |||
eukaryotic translation initiation factor 4E binding protein 2 | Eif4ebp2 | S44, T46 | TVAISDAAQLPQDYCTTPGGTLFS*TT*PGGTR | NP_034254 | 0.03 | |||
eukaryotic translation initiation factor 4, gamma 1 isoform b | Eif4g1 | S1224 | EATLPPVS*PPK | NP_001005331 | 0.04 | 0.06 | -0.1 | |
eukaryotic translation initiation factor 4, gamma 1 isoform b | Eif4g1 | S1182 | RSFS*KEVEER | NP_001005331 | ||||
eukaryotic translation initiation factor 4, gamma 1 isoform b | Eif4g1 | S1180 | S*FSKEVEER | NP_001005331 | -0.52 | |||
eukaryotic translation initiation factor 4, gamma 1 isoform b | Eif4g1 | S1189 | S*RERPSQPEGLR | NP_001005331 | ||||
eukaryotic translation initiation factor 4, gamma 1 isoform b | Eif4g1 | S1182 | SFS*KEVEER | NP_001005331 | -0.12 | 0.27 | ||
eukaryotic translation initiation factor 4, gamma 2 isoform 2 | Eif4g2 | T469 | TQT*PPLGQTPQLGLK | NP_001035221 | -1.34 | |||
eukaryotic translation initiation factor 4 gamma, 3 | Eif4g3 | S285 | TSS*PTSLPPLAR | NP_766291 | -0.13 | |||
eukaryotic translation initiation factor 5B | Eif5b | S215 | SVPTVDS*GNEDDDSSFK | NP_938045 | 0.03 | -0.06 | -0.1 | |
eukaryotic translation initiation factor 5B | Eif5b | S137, S139 | TARPNSEAPLS*GS*EDADDSNK | NP_938045 | -0.18 | |||
eukaryotic translation initiation factor 5B | Eif5b | S137 | TARPNSEAPLS*GSEDADDSNK | NP_938045 | 0.37 | 0 | ||
eukaryotic translation initiation factor 5B | Eif5b | S137 | TARPNSEAPLS*GSEDADDSNKLSK | NP_938045 | -0.2 | |||
eukaryotic translation initiation factor 5B | Eif5b | S139 | TARPNSEAPLSGS*EDADDSNK | NP_938045 | 0.29 | 0 | ||
eukaryotic translation initiation factor 5B | Eif5b | S139 | TARPNSEAPLSGS*EDADDSNKLSK | NP_938045 | ||||
eukaryotic translation initiation factor 5B | Eif5b | S114 | TSFDENDS*EELEDKDSK | NP_938045 | -0.18 | |||
E74-like factor 1 | Elf1 | S187 | TKPPRPDS*PTTTPNISVK | NP_031946 | -0.51 | -0.06 | ||
elongation factor RNA polymerase II | Ell | S133 | ARQS*MAQAEEETRSR | NP_031950 | 14.27 | |||
elongation factor RNA polymerase II | Ell | S300 | LCQPQNATTDSS*PPR | NP_031950 | 0.38 | |||
EMG1 nucleolar protein homolog | Emg1 | S16 | RFS*VQEQDWETTPPKK | NP_038564 | 0.73 | |||
echinoderm microtubule associated protein like 3 | Eml3 | S177 | AAS*SANLLLR | NP_659121 | 4.82 | |||
echinoderm microtubule associated protein like 3 | Eml3 | S177 | KAAS*SANLLLR | NP_659121 | 0.56 | |||
enabled homolog isoform 3 | Enah | T679 | GST*IETEQKEDRNEDAEPITAK | NP_001076589 | -0.47 | |||
enamelin | Enam | T820, S831 | WGDEEMNFKGNPT*VRQYEGEHYAS*TLAK | NP_059496 | ||||
enamelin | Enam | T820, T832 | WGDEEMNFKGNPT*VRQYEGEHYAST*LAK | NP_059496 | ||||
endosulfine alpha isoform b | Ensa | S67 | YFDS*GDYNMAK | NP_001021383 | -2.08 | -0.43 | -0.62 | |
E1A binding protein p300 | Ep300 | S1036 | TDGKEEEEQPSTSATQS*SPAPGQSK | NP_808489 | 0.53 | |||
E1A binding protein p300 | Ep300 | S1037 | TDGKEEEEQPSTSATQSS*PAPGQSK | NP_808489 | 0.53 | -0.11 | ||
erythrocyte protein band 4.1 isoform 2 | Epb4.1 | S649 | RLS*THSPFR | NP_001122078 | -0.31 | |||
erythrocyte protein band 4.1 isoform 2 | Epb4.1 | S556 | SLDGAAAAESTDRS*PRPTSAPAIAQSQVTEGPGAPIKK | NP_001122078 | -1.8 | |||
erythrocyte protein band 4.1-like 1 isoform b | Epb4.1l1 | S565 | APES*DTGDEDQDQER | NP_001003815 | -0.14 | |||
erythrocyte protein band 4.1-like 1 isoform b | Epb4.1l1 | S635 | DKS*DSETEGLVFAR | NP_001003815 | 0.91 | -0.34 | ||
erythrocyte protein band 4.1-like 1 isoform b | Epb4.1l1 | T672 | GACST*PEMPQFESVK | NP_001003815 | -0.69 | -0.61 | -0.66 | * |
erythrocyte protein band 4.1-like 1 isoform b | Epb4.1l1 | S497 | HQAS*INELKR | NP_001003815 | ||||
erythrocyte protein band 4.1-like 1 isoform b | Epb4.1l1 | S531 | LPSSPAS*PSPK | NP_001003815 | -4.85 | |||
erythrocyte protein band 4.1-like 1 isoform b | Epb4.1l1 | S527, S531 | RLPS*SPAS*PSPK | NP_001003815 | -4.35 | |||
erythrocyte protein band 4.1-like 1 isoform b | Epb4.1l1 | S527, S533 | RLPS*SPASPS*PK | NP_001003815 | -3.81 | |||
erythrocyte protein band 4.1-like 1 isoform b | Epb4.1l1 | S528, S531 | RLPSS*PAS*PSPK | NP_001003815 | -3.81 | |||
erythrocyte protein band 4.1-like 1 isoform b | Epb4.1l1 | S528, S533 | RLPSS*PASPS*PK | NP_001003815 | ||||
erythrocyte protein band 4.1-like 1 isoform b | Epb4.1l1 | S528 | RLPSS*PASPSPK | NP_001003815 | -2.66 | |||
erythrocyte protein band 4.1-like 1 isoform b | Epb4.1l1 | S531 | RLPSSPAS*PSPK | NP_001003815 | -2.62 | -1.99 | -2.64 | * |
erythrocyte protein band 4.1-like 1 isoform b | Epb4.1l1 | S533 | RLPSSPASPS*PK | NP_001003815 | -3.53 | -2.66 | -4.53 | * |
erythrocyte protein band 4.1-like 1 isoform b | Epb4.1l1 | T474 | RSEAEEGEVRT*PTK | NP_001003815 | -0.32 | |||
erythrocyte protein band 4.1-like 1 isoform b | Epb4.1l1 | T476 | RSEAEEGEVRTPT*K | NP_001003815 | -0.32 | |||
erythrocyte protein band 4.1-like 1 isoform b | Epb4.1l1 | T474 | SEAEEGEVRT*PTK | NP_001003815 | -1.6 | |||
erythrocyte protein band 4.1-like 1 isoform b | Epb4.1l1 | S635 | SLPELDRDKS*DSETEGLVFAR | NP_001003815 | 0.06 | |||
erythrocyte protein band 4.1-like 1 isoform b | Epb4.1l1 | S769 | SLS*PIIGK | NP_001003815 | -0.43 | -0.7 | -0.96 | * |
erythrocyte protein band 4.1-like 1 isoform a | Epb4.1l1 | S441 | SLDGAEFSRPAS*VSENHDAGPDGDKR | NP_001006665 | -0.65 | |||
erythrocyte protein band 4.1-like 2 | Epb4.1l2 | S38 | AKEVENEQTPVS*EPEEEKGSQPGPPVER | NP_038539 | -0.24 | |||
erythrocyte protein band 4.1-like 2 | Epb4.1l2 | S38 | EVENEQTPVS*EPEEEKGSQPGPPVER | NP_038539 | -0.18 | |||
erythrocyte protein band 4.1-like 2 | Epb4.1l2 | S666 | VTPLPFQPQASS*HETLNVVEEK | NP_038539 | -0.21 | |||
erythrocyte protein band 4.1-like 3 | Epb4.1l3 | S428 | RAS*ALIDRPAPYFER | NP_038841 | ||||
enhancer of polycomb homolog 2 | Epc2 | Y434 | Y*KHCLTTLTVPR | NP_766251 | ||||
ephrin receptor EphA2 | Epha2 | S893, S898 | VS*IRLPS*TSGSEGVPFR | NP_034269 | ||||
Eph receptor B1 | Ephb1 | Y575 | KRAYSKEAAY*SDK | NP_775623 | ||||
epsin 2 | Epn2 | S192 | AGGS*PASYHGSTSPR | NP_034278 | ||||
epsin 2 | Epn2 | S172 | GS*SQPNLSTSYSEQEYGK | NP_034278 | -0.03 | |||
epsin 2 | Epn2 | S173 | GSS*QPNLSTSYSEQEYGK | NP_034278 | -0.34 | |||
epsin 3 | Epn3 | S257 | GDDS*PVANGAEPAGQR | NP_082260 | -0.35 | -0.11 | ||
epsin 3 | Epn3 | S185 | GSPSSYTSASSS*PR | NP_082260 | -0.78 | |||
epsin 3 | Epn3 | S177 | SRGSPS*SYTSASSSPR | NP_082260 | 0.31 | |||
epsin 3 | Epn3 | S178 | SRGSPSS*YTSASSSPR | NP_082260 | -0.32 | |||
epsin 3 | Epn3 | Y179 | SRGSPSSY*TSASSSPR | NP_082260 | -0.33 | |||
epsin 3 | Epn3 | S257 | SWKGDDS*PVANGAEPAGQR | NP_082260 | -0.56 | |||
epsin 3 | Epn3 | S386 | TPVLPSGPPIADPWAPS*SPTR | NP_082260 | -0.23 | -0.56 | ||
epsin 3 | Epn3 | S387 | TPVLPSGPPIADPWAPSS*PTR | NP_082260 | -0.23 | -0.58 | ||
epsin 3 | Epn3 | T389 | TPVLPSGPPIADPWAPSSPT*R | NP_082260 | -0.28 | |||
epiplakin 1 | Eppk1 | S2705 | QVS*ASELCTSGILDR | NP_659097 | -1.07 | |||
epidermal growth factor receptor pathway substrate 15 isoform B | Eps15 | T465 | VGT*PTRPCPPPPGK | NP_001153436 | -1.95 | |||
epidermal growth factor receptor pathway substrate 15 isoform A | Eps15 | S106 | FHDS*SSPLLTSGPSVAELPWAVK | NP_031969 | 0.04 | |||
epidermal growth factor receptor pathway substrate 15 isoform A | Eps15 | S108 | FHDSSS*PLLTSGPSVAELPWAVK | NP_031969 | 0.05 | |||
epidermal growth factor receptor pathway substrate 8-like protein 1 | Eps8l1 | T187 | GASPAAET*PPLQR | NP_080422 | -3.68 | -0.89 | -1.5 | |
epidermal growth factor receptor pathway substrate 8-like protein 1 | Eps8l1 | S182, T187 | RGAS*PAAET*PPLQR | NP_080422 | -2.47 | |||
epidermal growth factor receptor pathway substrate 8-like protein 2 | Eps8l2 | S482 | HSLSSESQAPEDIAPPGS*SPHANR | NP_573454 | -1.39 | |||
epidermal growth factor receptor pathway substrate 8-like protein 2 | Eps8l2 | S483 | HSLSSESQAPEDIAPPGSS*PHANR | NP_573454 | -0.38 | -1.28 | ||
epidermal growth factor receptor pathway substrate 8-like protein 2 | Eps8l2 | S573 | YWGPAS*PTHK | NP_573454 | -1.58 | -0.46 | ||
epidermal growth factor receptor pathway substrate 8-like protein 2 | Eps8l2 | T575 | YWGPASPT*HK | NP_573454 | -1.58 | -0.42 | ||
epithelial stromal interaction 1 isoform a | Epsti1 | T248 | LQKT*RDGHQKNK | NP_083771 | ||||
Erbb2 interacting protein isoform 1 | Erbb2ip | S849 | S*TEDLSPQR | NP_001005868 | 0.75 | |||
epithelial splicing regulatory protein 2 | Esrp2 | S563 | SGLS*PPPCK | NP_789808 | -0.42 | |||
estrogen-related receptor gamma | Esrrg | Y356, S358 | KY*KS*MKLEK | NP_036065 | ||||
enhancer trap locus 4 | Etl4 | S1100 | IGGKS*PPPPPPPPR | NP_001074475 | ||||
enhancer trap locus 4 | Etl4 | S1894 | SSSLPSASGDSSNLPNAPATKPSIASTPLS*PQAGR | NP_001074475 | -1.39 | |||
enhancer trap locus 4 | Etl4 | S220 | TRAS*LPVVR | NP_001074475 | -0.09 | -0.26 | ||
ets variant 6 | Etv6 | Y17, S22 | ISY*TPPES*PVASHR | NP_031987 | 0.14 | |||
ets variant 6 | Etv6 | T18, S22 | ISYT*PPES*PVASHR | NP_031987 | 0.1 | |||
ets variant 6 | Etv6 | S240 | LQQENNHQETYPLSVS*PVENNHCLPSSPWQESTR | NP_031987 | 0.14 | |||
ets variant 6 | Etv6 | T31 | SST*PLHVHTVPR | NP_031987 | 0.72 | |||
ecotropic viral integration site 1 | Evi1 | S528 | MEPQS*PSEVKK | NP_031989 | -0.5 | |||
ecotropic viral integration site 1 | Evi1 | S835 | NFIGNS*NHGSQSPR | NP_031989 | 0.42 | |||
ecotropic viral integration site 1 | Evi1 | S841 | NFIGNSNHGSQS*PR | NP_031989 | 0.59 | -0.56 | 0.01 | |
ecotropic viral integration site 2A | Evi2a | S160 | S*KQVGKRQPR | NP_001028883 | ||||
envoplakin | Evpl | S2026 | AAS*PTLPR | NP_079552 | -0.5 | 0.15 | -0.04 | |
F11 receptor | F11r | S285 | VIYSQPS*TR | NP_766235 | 0.46 | 0.1 | -0.33 | |
PREDICTED: similar to putative retrovirus-related gag protein | F420015M19Rik | T140 | LAKSVEKT*K | XP_001003844 | ||||
coagulation factor V | F5 | S1873, T1874 | MPMGLS*T*GVISDSQIK | NP_032002 | -0.07 | |||
family with sequence similarity 117, member B isoform a | Fam117b | T101 | T*SPTVATQTGASVTSTR | NP_001032814 | -0.34 | |||
family with sequence similarity 117, member B isoform a | Fam117b | S102 | TS*PTVATQTGASVTSTR | NP_001032814 | -0.34 | |||
hypothetical protein LOC68034 | Fam122a | S73 | HGLLLPAS*PVR | NP_080796 | 0.2 | -0.12 | ||
hypothetical protein LOC68034 | Fam122a | S144 | RIDFIPVSPAPS*PTR | NP_080796 | ||||
hypothetical protein LOC68034 | Fam122a | S59 | RNS*TTFPSR | NP_080796 | 1.01 | |||
hypothetical protein LOC68034 | Fam122a | T60 | RNST*TFPSR | NP_080796 | 1.02 | |||
hypothetical protein LOC68034 | Fam122a | S34 | SNS*APLIHGLSDSSPVFQAEAPSAR | NP_080796 | 0.1 | |||
family with sequence similarity 125, member A | Fam125a | S168 | GLS*LDPPKEPSK | NP_082893 | -0.04 | |||
family with sequence similarity 129, member A | Fam129a | S580 | HNLFEDNMALPSESVS*SLTDLK | NP_071301 | 0.38 | |||
family with sequence similarity 129, member A | Fam129a | S581 | HNLFEDNMALPSESVSS*LTDLK | NP_071301 | 0.6 | |||
family with sequence similarity 129, member A | Fam129a | S755 | IHPEASHPAAIQQDS*CEER | NP_071301 | -0.05 | -0.27 | ||
family with sequence similarity 129, member A | Fam129a | S601 | RVS*AILPGAPDNELPSNEVFQEPEEK | NP_071301 | 1.26 | 0.36 | ||
family with sequence similarity 129, member A | Fam129a | S595 | TAMGSNQAS*PAR | NP_071301 | -0.86 | |||
hypothetical protein LOC68187 | Fam135a | S868, T876 | SAVPDCHLSDS*KTVFNLGT*MDLPKCDDTK | NP_080880 | ||||
hypothetical protein LOC320159 | Fam179a | S292, S295 | S*PAS*KPLVPVVKAK | NP_796061 | ||||
hypothetical protein LOC229707 | Fam40a | S335 | AAS*PPASASDLIEQQQK | NP_705791 | 0.03 | |||
hypothetical protein LOC76824 | Fam54b | S38 | AS*FETLPNISDLCLK | NP_084035 | 4.36 | |||
hypothetical protein LOC76824 | Fam54b | S235 | ASS*FADMMGILK | NP_084035 | 0.63 | -0.47 | ||
hypothetical protein LOC76824 | Fam54b | S100 | NAS*VPNLR | NP_084035 | 0.16 | -0.14 | ||
hypothetical protein LOC72826 | Fam76b | S193 | SSLS*PEQEQGLWK | NP_789806 | 0.12 | |||
hypothetical protein LOC72826 | Fam76b | S191 | VSS*LSPEQEQGLWK | NP_789806 | 0.23 | |||
hypothetical protein LOC72826 | Fam76b | S193 | VSSLS*PEQEQGLWK | NP_789806 | -0.59 | 0.17 | ||
family with sequence similarity 82, member A2 | Fam82a2 | S44 | S*HSLPNSLDYAQASER | NP_001028308 | 0.88 | 1.55 | ||
family with sequence similarity 82, member A2 | Fam82a2 | S46 | SHS*LPNSLDYAQASER | NP_001028308 | 1.4 | |||
hypothetical protein LOC213956 | Fam83f | Y308 | IGLNY*SSTVARKLINPK | NP_666098 | ||||
family with sequence similarity 83, member H | Fam83h | T939 | GSPT*STYPDR | NP_598848 | ||||
family with sequence similarity 83, member H | Fam83h | S522 | HGS*DPAFGPSPR | NP_598848 | -1.13 | -0.96 | -0.54 | * |
family with sequence similarity 83, member H | Fam83h | S882 | KGS*PTPAYPER | NP_598848 | 0.28 | -0.06 | -0.18 | |
family with sequence similarity 83, member H | Fam83h | S882 | KGS*PTPAYPERK | NP_598848 | -0.18 | |||
family with sequence similarity 83, member H | Fam83h | S904 | KGS*PTQAYPER | NP_598848 | 0.17 | 0.17 | ||
family with sequence similarity 83, member H | Fam83h | S915 | KGS*PTSGFPNR | NP_598848 | -0.24 | -0.1 | -0.11 | |
family with sequence similarity 83, member H | Fam83h | T884 | KGSPT*PAYPER | NP_598848 | -0.07 | -0.09 | -0.28 | |
family with sequence similarity 83, member H | Fam83h | T906 | KGSPT*QAYPER | NP_598848 | -0.1 | |||
family with sequence similarity 83, member H | Fam83h | T917 | KGSPT*SGFPNR | NP_598848 | -0.09 | |||
family with sequence similarity 83, member H | Fam83h | S970 | RGS*LTFAGESSK | NP_598848 | 0.5 | 0.65 | 0.59 | * |
family with sequence similarity 83, member H | Fam83h | S926 | RGS*PTTGLMEQK | NP_598848 | 0.31 | -0.03 | 0.11 | |
family with sequence similarity 83, member H | Fam83h | S948 | RGS*PVPPVPER | NP_598848 | -0.38 | -0.17 | -0.16 | |
family with sequence similarity 83, member H | Fam83h | S948 | RGS*PVPPVPERR | NP_598848 | 0.87 | |||
family with sequence similarity 83, member H | Fam83h | T972 | RGSLT*FAGESSK | NP_598848 | 0.46 | 2 | ||
family with sequence similarity 83, member H | Fam83h | T928 | RGSPT*TGLMEQK | NP_598848 | 0.19 | |||
family with sequence similarity 83, member H | Fam83h | T929 | RGSPTT*GLMEQK | NP_598848 | ||||
Fanconi anemia, complementation group A | Fanca | S46 | EQKLKDS*ALKLLR | NP_058621 | 5.07 | |||
FERMRhoGEF (Arhgef) and pleckstrin domain protein 1 | Farp1 | S23 | LGAPENSGIS*TLER | NP_598843 | 0.25 | |||
FERMRhoGEF (Arhgef) and pleckstrin domain protein 1 | Farp1 | T24 | LGAPENSGIST*LER | NP_598843 | 1.12 | 0.23 | 0.01 | |
FERMRhoGEF (Arhgef) and pleckstrin domain protein 1 | Farp1 | S892, S899, S902 | SPDEATAADQES*EDDLSAS*RTS*LER | NP_598843 | -0.45 | |||
FERM, RhoGEF and pleckstrin domain protein 2 | Farp2 | T372 | T*RTSLHALTVDLPK | NP_663494 | ||||
FERM, RhoGEF and pleckstrin domain protein 2 | Farp2 | S375 | TRTS*LHALTVDLPK | NP_663494 | 0.66 | |||
fibrillarin | Fbl | S130 | RVS*ISEGDDKIEYR | NP_032017 | 0.33 | |||
F-box protein 31 | Fbxo31 | S33 | QQRRGPAETAAADS*EADTDPEEER | NP_598526 | ||||
F-box and WD-40 domain protein 9 | Fbxw9 | T289 | KVT*IYDPR | NP_081067 | ||||
farnesyl diphosphate synthase | Fdps | S195 | YKS*IVK | NP_608219 | 8.83 | |||
flap structure specific endonuclease 1 | Fen1 | S25 | ENDIKS*YFGR | NP_032025 | ||||
FIP1 like 1 isoform 1 | Fip1l1 | S479 | DHS*PTPSVFNSDEER | NP_001153045 | 0.4 | -0.05 | ||
FIP1 like 1 isoform 1 | Fip1l1 | T481 | DHSPT*PSVFNSDEER | NP_001153045 | 0.01 | |||
FIP1 like 1 isoform 1 | Fip1l1 | S479 | ERDHS*PTPSVFNSDEER | NP_001153045 | -0.54 | 0.02 | ||
FIP1 like 1 isoform 1 | Fip1l1 | T481 | ERDHSPT*PSVFNSDEER | NP_001153045 | 0.28 | |||
FK506 binding protein 15 | Fkbp15 | S1157 | HNQDSQHCS*LSGDEEDELFK | NP_001038993 | ||||
FK506 binding protein 15 | Fkbp15 | S1159 | HNQDSQHCSLS*GDEEDELFK | NP_001038993 | -0.43 | |||
FK506 binding protein 15 | Fkbp15 | S1091 | RLS*LTPDPEKGEPPALDPESQGGEAQPPECK | NP_001038993 | -0.22 | |||
FK506 binding protein 3, 25kDa | Fkbp3 | S34 | FLQDHGS*DSFLAEHK | NP_038930 | ||||
FK506 binding protein 3, 25kDa | Fkbp3 | S36 | FLQDHGSDS*FLAEHK | NP_038930 | ||||
folliculin | Flcn | S62 | AHS*PAEGASSESSSPGPK | NP_666130 | 0.81 | |||
filamin, alpha | Flna | S2144 | RAPS*VANIGSHCDLSLK | NP_034357 | 1.12 | 1.37 | ||
filamin, alpha | Flna | S959 | S*PFSVGVSPSLDLSKIK | NP_034357 | ||||
filamin C, gamma | Flnc | S2234 | LGS*FGSITR | NP_001074654 | -0.4 | 0.23 | 0.41 | |
FMS-like tyrosine kinase 3 | Flt3 | T164 | DT*QLYVLR | NP_034359 | ||||
formin 1 isoform 2 | Fmn1 | S524, S527 | RLSPVPS*PLS*PR | NP_001036787 | ||||
formin-like 1 isoform 2 | Fmnl1 | S264 | S*PRTKALVLELLAAVCLVR | NP_001071166 | ||||
formin binding protein 1-like isoform 1 | Fnbp1l | S501 | ES*PEGSYTDDANQEVR | NP_001108137 | -0.24 | |||
formin binding protein 1-like isoform 1 | Fnbp1l | S295 | TIS*DGTISAAK | NP_001108137 | -0.19 | -0.39 | -0.37 | * |
formin binding protein 4 | Fnbp4 | S486 | ALEEGDGSVSGSS*PR | NP_061298 | -0.89 | -0.15 | 0.06 | |
formin binding protein 4 | Fnbp4 | S65 | RPILQLS*PPGPR | NP_061298 | 0.03 | |||
fibronectin type III domain containing 7 | Fndc7 | T587, T598 | CHT*HQNHCLLGCIT*CGINYTVALK | NP_796065 | ||||
folliculin interacting protein 2 | Fnip2 | T500 | LTRT*VVIGK | NP_001156471 | 8.03 | |||
farnesyltransferase, CAAX box, alpha | Fnta | Y358 | EYWRY*IGRSLQSKHCR | NP_032059 | ||||
forkhead box C1 | Foxc1 | T230, T234 | T*ENGT*CPSPPQPLSPAAALGSGSAATVPK | NP_032618 | 0.09 | |||
forkhead box C1 | Foxc1 | T234, S243 | TENGT*CPSPPQPLS*PAAALGSGSAATVPK | NP_032618 | -0.17 | |||
forkhead box C1 | Foxc1 | S237, S243 | TENGTCPS*PPQPLS*PAAALGSGSAATVPK | NP_032618 | 0.03 | -0.12 | -0.37 | |
forkhead box K1 | Foxk1 | S199 | EEAPAS*PLRPLYPQISPLK | NP_951031 | -0.17 | |||
forkhead box K1 | Foxk1 | S431 | EGS*PIPHDPDLGSK | NP_951031 | -0.33 | 0.14 | 0 | |
forkhead box K1 | Foxk1 | T422, S427 | SSGLQT*PECLS*R | NP_951031 | -0.14 | |||
forkhead box K2 | Foxk2 | S389 | EGS*PAPLEPEPGASQPK | NP_001074401 | -0.08 | |||
PREDICTED: similar to FRAS1-related extracellular matrix protein 3 precursor (NV domain-containing protein 2) | Frem3 | S2066 | QHLHFS*PGVSVQR | XP_911424 | 6.31 | |||
FSHD region gene 1 | Frg1 | Y4, S5, Y6 | MAEY*S*Y*VK | NP_038550 | ||||
fibroblast growth factor receptor substrate 3 | Frs3 | S384 | SHS*GFPVPLTR | NP_659188 | ||||
furry homolog-like isoform 1 | Fryl | S1979 | TRS*LSSLR | NP_082470 | 0.24 | |||
PREDICTED: similar to fibrous sheath-interacting protein 2 | Fsip2 | S6457, T6459, S6461 | QGSRVLAKVS*ST*LS*KVFSR | XP_141020 | ||||
PREDICTED: similar to fibrous sheath-interacting protein 2 | Fsip2 | S129, T133, S134, T137 | SDS*HLLT*S*LET*CTKK | XP_141020 | -5.02 | |||
FUN14 domain containing 2 | Fundc2 | T22 | FEALDLAELT*KK | NP_080402 | ||||
FUS interacting protein (serine-arginine rich) 1 isoform 2 | Fusip1 | S133 | S*FDYNYR | NP_001073856 | 0.17 | |||
FUS interacting protein (serine-arginine rich) 1 isoform 2 | Fusip1 | S131, S133 | S*RS*FDYNYR | NP_001073856 | 0.79 | |||
fragile X mental retardation-related protein 1 isoform 1 | Fxr1 | S438 | RGPNYTSGYGTNSELSNPS*ETESER | NP_001106659 | 0.15 | |||
fragile X mental retardation-related protein 2 | Fxr2 | T413 | AGYTT*DESSSSSLHTTR | NP_035944 | 0.58 | -3.6 | ||
fragile X mental retardation-related protein 2 | Fxr2 | S455 | TGGPAYGPSSDPSTAS*ETESEKR | NP_035944 | ||||
corticosteroid-induced protein | Fxyd4 | T87 | ATPLIIPGSANT*C | NP_387468 | ||||
corticosteroid-induced protein | Fxyd4 | T87 | IIPGSANT*C | NP_387468 | ||||
ras-GTPase-activating protein SH3-domain binding protein | G3bp1 | S229 | S*TSPAPADVAPAQEDLR | NP_038744 | 0.18 | -0.09 | 0.02 | |
ras-GTPase-activating protein SH3-domain binding protein | G3bp1 | T230 | ST*SPAPADVAPAQEDLR | NP_038744 | 0.05 | -0.06 | 0.06 | |
ras-GTPase-activating protein SH3-domain binding protein | G3bp1 | S231 | STS*PAPADVAPAQEDLR | NP_038744 | 0.05 | -0.06 | 0.11 | |
ras-GTPase-activating protein SH3-domain binding protein | G3bp1 | S149 | YQDEVFGGFVTEPQEES*EEEVEEPEER | NP_038744 | 0.28 | -0.12 | 0.27 | |
Ras-GTPase-activating protein (GAP120) SH3-domain binding protein 2 isoform a | G3bp2 | S225 | S*ATPPPAEPASLPQEPPK | NP_001074263 | 0.09 | |||
Ras-GTPase-activating protein (GAP120) SH3-domain binding protein 2 isoform a | G3bp2 | T227 | SAT*PPPAEPASLPQEPPK | NP_001074263 | 0.29 | 0 | 0.04 | |
Ras-GTPase-activating protein (GAP120) SH3-domain binding protein 2 isoform b | G3bp2 | S225 | S*ATPPPAEPASLPQEPPKPR | NP_001074264 | 0.1 | -0.08 | ||
Ras-GTPase-activating protein (GAP120) SH3-domain binding protein 2 isoform b | G3bp2 | T227 | SAT*PPPAEPASLPQEPPKPR | NP_001074264 | -0.36 | -0.08 | ||
glucose-6-phosphate dehydrogenase 2 | G6pd2 | T91, T103 | AT*PEERPKLEEFFT*R | NP_062341 | ||||
glyceraldehyde-3-phosphate dehydrogenase | Gapdh | T151, T152 | IVSNASCT*T*N | NP_032110 | ||||
glyceraldehyde-3-phosphate dehydrogenase | Gapdh | T73 | LVINGKPIT*IFQER | NP_032110 | ||||
GTPase activating protein and VPS9 domains 1 | Gapvd1 | S879 | S*RSSDIVSSVR | NP_079985 | 2.87 | |||
GTPase activating protein and VPS9 domains 1 | Gapvd1 | S881 | SRS*SDIVSSVR | NP_079985 | -0.49 | -0.32 | 0.07 | |
p66 alpha isoform b | Gatad2a | S96, S103, S109 | RPPS*PDVIVLS*DSEQPS*SPR | NP_001106816 | ||||
p66 alpha isoform b | Gatad2a | S96, S103, S110 | RPPS*PDVIVLS*DSEQPSS*PR | NP_001106816 | -0.27 | |||
glucosidase, beta, acid isoform 2 | Gba | S291 | DFISRDLGPALANSS*HDVK | NP_001070879 | ||||
golgi-specific brefeldin A-resistance factor 1 | Gbf1 | S1298 | ADAPDAGAQS*DSELPSYHQNDVSLDR | NP_849261 | -0.19 | |||
golgi-specific brefeldin A-resistance factor 1 | Gbf1 | S1318 | GYTS*DSEVYTDHGRPGK | NP_849261 | -0.28 | 0.41 | ||
golgi-specific brefeldin A-resistance factor 1 | Gbf1 | S1320 | GYTSDS*EVYTDHGRPGK | NP_849261 | -0.26 | |||
glutamate-cysteine ligase, modifier subunit | Gclm | S100, S103, S105, T106 | VSAKLFIVGS*NSS*SS*T*R | NP_032155 | ||||
growth differentiation factor 11 | Gdf11 | T202 | LKPLT*GEGTAGGGGGGRRHIR | NP_034402 | ||||
guanosine diphosphate (GDP) dissociation inhibitor 2 | Gdi2 | T425 | MT*GSEFDFEEMKR | NP_032138 | ||||
gem (nuclear organelle) associated protein 5 | Gemin5 | S1410, S1414 | APS*QPPS*PTEER | NP_766146 | 0.39 | |||
glial fibrillary acidic protein isoform 1 | Gfap | T107, Y113 | AKEPT*KLADVY*QAELR | NP_001124492 | ||||
glutamine fructose-6-phosphate transaminase 1 | Gfpt1 | S243 | VDS*TTCLFPVEEK | NP_038556 | 0.48 | 0.03 | -0.16 | |
glutamine fructose-6-phosphate transaminase 1 | Gfpt1 | T244 | VDST*TCLFPVEEK | NP_038556 | -0.01 | |||
gamma-glutamyl hydrolase | Ggh | T178, S183, S197, S199 | HFPT*ELLDS*LALENLTANFHKWS*LS*VK | NP_034411 | ||||
PERQ amino acid rich, with GYF domain 1 | Gigyf1 | S137 | S*IEEGDGAFGR | NP_113596 | ||||
GRB10 interacting GYF protein 2 isoform b | Gigyf2 | T377 | AGAEASEEVPQTSLSSARPGT*PSDHQPQEATQFER | NP_001103682 | 0.5 | -0.58 | ||
GRB10 interacting GYF protein 2 isoform b | Gigyf2 | S26, S30 | ALSSGGSITS*PPLS*PALPK | NP_001103682 | -24.29 | -1.47 | ||
GRB10 interacting GYF protein 2 isoform a | Gigyf2 | S237 | WRPHS*PDGPR | NP_666224 | -0.26 | -0.04 | ||
GTPase, IMAP family member 1 | Gimap1 | S128 | FTMQDS*QALAAVK | NP_032402 | -4.58 | |||
GTPase, IMAP family member 1 | Gimap1 | T37 | LILVGRTGT*GK | NP_032402 | ||||
GTPase, IMAP family member 9 | Gimap9 | T64, T70 | NLVVVDT*PGLFDT*K | NP_777620 | ||||
hypothetical protein LOC237558 | Gm239 | T599, S601, S608 | RT*GS*KKPTKVS*FSGR | NP_001028505 | ||||
otolin-1 | Gm414 | S278, S284, S294 | GDVGS*EGKRGS*DGLPGLRGDS*GPK | NP_001018041 | ||||
PREDICTED: similar to Gm444 protein | Gm444 | S830 | FIGLS*EDVVSFFARER | XP_144253 | ||||
hypothetical protein LOC238395 | Gm4931 | T235, S240 | RT*PVKVS*MMKMK | NP_001094942 | ||||
hypothetical protein LOC240327 | Gm4951 | T346, T352 | SPAVFT*PTDEET*IQERLSR | NP_001028939 | ||||
hypothetical protein LOC331392 | Gm5124 | S431, S433, S434 | ANS*SS*S*EEEEEEEERR | NP_941035 | ||||
hypothetical protein LOC434172 | Gm5592 | T432, S433 | VT*S*GPSDQVRKNK | NP_001028954 | >10 | |||
hypothetical protein LOC207806 | Gm608 | S1653, S1664 | NRVSSYSAEALIGKS*SSTSDQRMGIS*IQGSR | NP_001025060 | ||||
hypothetical protein LOC380882 | Gm906 | S141, S148 | S*VRFSDDS*GPDKAPSK | NP_001028610 | ||||
predicted gene 9294 | Gm9294 | T2 | MT*RGPKKHLKR | NP_001074505 | ||||
Gem-interacting protein | Gmip | S436, S439 | SLDS*PTS*SPGAGAR | NP_932769 | ||||
Gem-interacting protein | Gmip | S436, S440 | SLDS*PTSS*PGAGAR | NP_932769 | -0.47 | |||
guanine monophosphate synthetase | Gmps | T331 | TLNMTT*SPEEK | NP_001028472 | 0.52 | 0.01 | ||
guanine monophosphate synthetase | Gmps | S332 | TLNMTTS*PEEK | NP_001028472 | 0.57 | |||
guanine nucleotide binding protein (G protein), alpha inhibiting 2 | Gnai2 | S75 | AVVYS*NTIQSIMAIVK | NP_032164 | -5.92 | |||
guanine nucleotide binding protein, related sequence 1 | Gnal1 | S51 | EEQTDTS*DGESVTHHIR | NP_032162 | 0.18 | |||
guanine nucleotide binding protein-like 2 (nucleolar) | Gnl2 | T642, S643, S647 | EEKKT*S*AEDS*DAAPTKK | NP_663527 | ||||
guanine nucleotide binding protein-like 3 (nucleolar) long isoform | Gnl3 | S505 | ELS*PEQSTAGKPSDGSSALDR | NP_705775 | 0.02 | 0.42 | ||
golgi autoantigen, golgin subfamily a, 5 | Golga5 | S116 | KKS*EPDDELLFDFLNSSQK | NP_038775 | 1.54 | 2.5 | ||
golgi autoantigen, golgin subfamily a, 5 | Golga5 | S116 | KKS*EPDDELLFDFLNSSQKEPTGR | NP_038775 | 1.35 | |||
golgi autoantigen, golgin subfamily a, 5 | Golga5 | S116 | S*EPDDELLFDFLNSSQK | NP_038775 | 2.07 | |||
golgi autoantigen, golgin subfamily b, macrogolgin 1 | Golgb1 | S2655 | KVS*EIEDQLKK | NP_084311 | 5.71 | 6.13 | ||
golgi membrane protein 1 | Golm1 | S213 | LQEEVPS*EEQMPQEK | NP_001030294 | 0.33 | |||
golgi reassembly stacking protein 2 | Gorasp2 | S432 | VPTTVEDRVS*DCTPAVEKPVSDADASEPS | NP_081628 | 0.17 | |||
glypican 4 | Gpc4 | Y64, T65, S68 | ICPQDY*T*CCS*QEMEEKYSLQSKDDFK | NP_032176 | >10 | |||
G patch domain and KOW motifs | Gpkow | S348 | KHS*PDRQDGPVPK | NP_776108 | 0.42 | |||
GPN-loop GTPase 1 | Gpn1 | S338 | GTLDEEDEEADS*DTDDIDHR | NP_598517 | 0.03 | |||
G protein-coupled receptor 124 | Gpr124 | T1151 | GDGEPEPT*GSR | NP_473385 | ||||
G protein-coupled receptor 143 | Gpr143 | T216, T218, S219 | T*VT*S*VASLLKGR | NP_035081 | ||||
G protein-coupled receptor 158 | Gpr158 | S239 | RGS*NQGPRGLGHSWRR | NP_001004761 | -13.89 | |||
G protein-coupled receptor 55 | Gpr55 | Y124 | Y*PILASHLR | NP_001028462 | 0.25 | |||
G protein-coupled receptor 81 | Gpr81 | T219, S227, Y233 | AT*RFIMVVAS*VFITCY*LPSVLAR | NP_780729 | 2.05 | |||
G protein-coupled receptor, family C, group 5, member A | Gprc5a | S344 | AQAPAS*PYNDYEGR | NP_852109 | -0.75 | -2.28 | -2.34 | |
G protein pathway suppressor 1 | Gps1 | S454 | EGS*QGELTPANSQSR | NP_663345 | 0.89 | |||
GRAM domain containing 3 | Gramd3 | T220, S225 | SVCGHLENT*SVGNS*PNPSSAENSFR | NP_080516 | -0.41 | |||
GRAM domain containing 3 | Gramd3 | S221, S225 | SVCGHLENTS*VGNS*PNPSSAENSFR | NP_080516 | -0.41 | |||
GRP1 (general receptor for phosphoinositides 1)-associated scaffold protein | Grasp | T102 | KVLT*LEK | NP_062391 | >10 | |||
GRP1 (general receptor for phosphoinositides 1)-associated scaffold protein | Grasp | T16 | LQQKEEAT*AAPDPAGRAPDSEAAR | NP_062391 | ||||
growth factor receptor bound protein 10 | Grb10 | T135, S140 | T*TARFS*KK | NP_034475 | ||||
growth factor receptor bound protein 7 | Grb7 | S364 | LSYLGS*PPLR | NP_034476 | -0.49 | 0.4 | ||
growth factor receptor bound protein 7 | Grb7 | S414 | TNHRLS*LPTTCSGSSLSAAIHR | NP_034476 | -0.02 | |||
Greb1 protein | Greb1 | S1092 | NEALES*DGEK | NP_056579 | ||||
glutamate receptor, ionotropic, AMPA3 precursor | Gria3 | Y699, T709 | RSKIAVYEKMWSY*MKSAEPSVFT*K | NP_058582 | ||||
glutamate receptor, ionotropic, delta 1 | Grid1 | T214 | T*EELNRYRDTLR | NP_032192 | ||||
glutamate receptor, ionotropic, delta 2 | Grid2 | S544 | YMDYS*VGVLLR | NP_032193 | ||||
Rho GTPase-activating protein | Grit | S354 | S*AKSEESLTSLHAVDGDSK | NP_796353 | -0.01 | |||
Rho GTPase-activating protein | Grit | S357 | SAKS*EESLTSLHAVDGDSK | NP_796353 | 0.02 | |||
Rho GTPase-activating protein | Grit | S543 | VVYAFS*PK | NP_796353 | -1.18 | |||
glucocorticoid receptor DNA binding factor 1 | Grlf1 | S1150 | KVS*AVSKPVLYR | NP_766327 | ||||
glycogen synthase kinase 3 alpha | Gsk3a | S278 | GEPNVS*YICSR | NP_001026837 | 0.16 | 0.09 | 0.22 | |
glycogen synthase kinase 3 alpha | Gsk3a | Y279 | GEPNVSY*ICSR | NP_001026837 | -0.17 | -0.03 | 0.08 | |
glycogen synthase kinase 3 beta | Gsk3b | S9 | TTS*FAESCKPVQQPSAFGSMK | NP_062801 | 0.07 | |||
glutathione S-transferase mu 1 | Gstm1 | T24 | MLLEYT*DSSYDEK | NP_034488 | ||||
glutathione S-transferase mu 1 | Gstm1 | T34 | RYT*MGDAPDFDR | NP_034488 | -0.12 | |||
glutathione S-transferase mu 2 | Gstm2 | T34 | YT*MGDAPDYDR | NP_032209 | ||||
glutathione S-transferase mu 6 | Gstm6 | S206 | FLPS*PVYLK | NP_032210 | -7.59 | |||
general transcription factor IIF, polypeptide 1 | Gtf2f1 | T384, S385 | GT*S*RPGTPSAEAASTSSTLR | NP_598562 | 0.21 | -0.3 | ||
general transcription factor IIF, polypeptide 1 | Gtf2f1 | T384, T389 | GT*SRPGT*PSAEAASTSSTLR | NP_598562 | 0.25 | |||
general transcription factor IIF, polypeptide 1 | Gtf2f1 | T384, S391 | GT*SRPGTPS*AEAASTSSTLR | NP_598562 | -0.44 | |||
general transcription factor IIF, polypeptide 1 | Gtf2f1 | S385, T389 | GTS*RPGT*PSAEAASTSSTLR | NP_598562 | 0.38 | -0.24 | ||
general transcription factor IIF, polypeptide 1 | Gtf2f1 | S385, S391 | GTS*RPGTPS*AEAASTSSTLR | NP_598562 | 0.66 | |||
general transcription factor IIF, polypeptide 1 | Gtf2f1 | T437 | ST*PSSGDVQVTEDAVR | NP_598562 | -0.67 | |||
general transcription factor III C 1 | Gtf3c1 | S1890 | VAAS*PRPGAEEQAEAQAPAQLAAPEDADAGGPR | NP_997122 | 0.38 | -0.06 | ||
GTP binding protein 1 | Gtpbp1 | S8, S25 | SRS*PVDSPVPASMFAPEPSS*PGAAR | NP_038846 | -0.85 | |||
guanylate cyclase 2f | Gucy2f | T853, T858, S864, S868 | T*EKLLT*QMLPLS*VAES*LK | NP_001007577 | ||||
glycogen synthase 1 (muscle) | Gys1 | S641, S645 | YPRPAS*VPPS*PSLSR | NP_109603 | -0.06 | |||
histocompatibility 2, M region locus 2 | H2-M2 | S279 | WVAVVVPS*GK | NP_032230 | ||||
HAUS augmin-like complex, subunit 6 | Haus6 | S405 | DRPAAVDLLPPMS*PLTFDPVSEEVYAK | NP_775576 | -1.03 | |||
histone deacetylase 1 | Hdac1 | S421, S423 | IACEEEFS*DS*DEEGEGGRK | NP_032254 | 0.17 | |||
histone deacetylase 1 | Hdac1 | S393 | MLPHAPGVQMQAIPEDAIPEES*GDEDEEDPDKR | NP_032254 | 0.83 | -0.44 | ||
histone deacetylase 2 | Hdac2 | S422, S424 | IACDEEFS*DS*EDEGEGGRR | NP_032255 | -0.06 | |||
histone deacetylase 2 | Hdac2 | S394 | MLPHAPGVQMQAIPEDAVHEDS*GDEDGEDPDKR | NP_032255 | 0.46 | -0.79 | ||
hepatoma-derived growth factor | Hdgf | S165 | AGDVLEDS*PK | NP_032257 | -0.15 | -0.33 | -0.13 | |
hepatoma-derived growth factor | Hdgf | S165 | AGDVLEDS*PKRPK | NP_032257 | 0.35 | -0.14 | ||
hepatoma-derived growth factor | Hdgf | S165 | GDVLEDS*PKRPK | NP_032257 | 0.15 | |||
hepatoma-derived growth factor | Hdgf | S132, S133 | GSAEGS*S*DEEGKLVIDEPAK | NP_032257 | 0.31 | -0.09 | ||
hepatoma-derived growth factor | Hdgf | S132, S133 | GSAEGS*S*DEEGKLVIDEPAKEK | NP_032257 | -0.36 | |||
hepatoma-derived growth factor | Hdgf | S132 | GSAEGS*SDEEGKLVIDEPAK | NP_032257 | 0.64 | |||
hepatoma-derived growth factor | Hdgf | S132 | GSAEGS*SDEEGKLVIDEPAKEK | NP_032257 | -0.08 | |||
hepatoma-derived growth factor | Hdgf | S133 | GSAEGSS*DEEGKLVIDEPAK | NP_032257 | 0.4 | 0.76 | ||
hepatoma-derived growth factor | Hdgf | S133 | GSAEGSS*DEEGKLVIDEPAKEK | NP_032257 | 0.33 | |||
hepatoma-derived growth factor | Hdgf | S132, S133 | KGSAEGS*S*DEEGKLVIDEPAK | NP_032257 | -0.41 | |||
hepatoma-derived growth factor | Hdgf | S132 | KGSAEGS*SDEEGKLVIDEPAK | NP_032257 | -0.39 | |||
hepatoma-derived growth factor | Hdgf | S199 | NS*TPSEPDSGQGPPAEEEEGEEEAAKEEAEAQGVR | NP_032257 | 0.1 | -0.63 | ||
hepatoma-derived growth factor | Hdgf | T200 | NST*PSEPDSGQGPPAEEEEGEEEAAKEEAEAQGVR | NP_032257 | 0.32 | -0.67 | ||
hepatoma-derived growth factor | Hdgf | S202 | NSTPS*EPDSGQGPPAEEEEGEEEAAKEEAEAQGVR | NP_032257 | 0.31 | -0.67 | ||
hepatoma-derived growth factor | Hdgf | S206 | NSTPSEPDS*GQGPPAEEEEGEEEAAKEEAEAQGVR | NP_032257 | -0.25 | |||
hepatoma-derived growth factor | Hdgf | S165 | RAGDVLEDS*PK | NP_032257 | 0.02 | 0.18 | -0.07 | |
hepatoma-derived growth factor | Hdgf | S165 | RAGDVLEDS*PKRPK | NP_032257 | 0.44 | -0.05 | ||
hepatoma-derived growth factor-related protein 2 | Hdgfrp2 | S620 | AQEDGQDS*EDGPR | NP_032259 | -0.01 | |||
hepatoma-derived growth factor-related protein 2 | Hdgfrp2 | S366, S367 | GGS*S*GEELEDEEPVK | NP_032259 | 0.08 | |||
hepatoma-derived growth factor-related protein 2 | Hdgfrp2 | S366, S367 | GGS*S*GEELEDEEPVKK | NP_032259 | 0.04 | |||
hepatoma-derived growth factor-related protein 2 | Hdgfrp2 | S450 | KRS*EGLSLER | NP_032259 | 0.37 | |||
hepatoma-derived growth factor-related protein 2 | Hdgfrp2 | S659, S661 | TRLAS*ES*ANDDNEDS | NP_032259 | 0.66 | |||
HECT domain containing 1 | Hectd1 | S1567 | TNATNNMNLS*R | NP_659037 | -1.47 | -1.84 | ||
hect domain and RLD 5 | Herc5 | S980 | MLDLPKYS*SMRRMK | NP_080268 | ||||
hexamethylene bis-acetamide inducible 1 | Hexim1 | S103 | GQNGEDLSTGGAS*PSAEGEPMSESLVQPGHDSEATK | NP_620092 | 0.19 | |||
hexamethylene bis-acetamide inducible 1 | Hexim1 | S105 | GQNGEDLSTGGASPS*AEGEPMSESLVQPGHDSEATK | NP_620092 | 0 | |||
HGF-regulated tyrosine kinase substrate isoform 1 | Hgs | S345 | KS*PTPSAPVPLTEPAAQPGEGHTAPN | NP_001152800 | 0.3 | |||
hypoxia inducible factor 3, alpha subunit isoform 1 | Hif3a | S165, S174 | LEAPTERHFS*LRMKSTLTS*R | NP_001156422 | ||||
homeodomain interacting protein kinase 2 isoform 1 | Hipk2 | Y354 | AVCSTY*LQSR | NP_001129537 | 0.16 | |||
HIRA interacting protein 3 | Hirip3 | S231, S234 | AKVEGSTGANCQEES*EES*GEESPAK | NP_766334 | -0.43 | |||
HIRA interacting protein 3 | Hirip3 | S575 | TLDS*EEEQPR | NP_766334 | 0.28 | |||
histone cluster 1, H1b | Hist1h1b | S2, T4, S18 | S*ET*APAETAAPAPVEKS*PAK | NP_064418 | ||||
histone cluster 1, H1d | Hist1h1d | S2, T4, T18 | S*ET*APAAPAAPAPVEKT*PVK | NP_663759 | ||||
histone cluster 2, H4 | Hist2h4 | S48 | RIS*GLIYEETR | NP_291074 | 2.45 | -0.25 | 0.12 | |
human immunodeficiency virus type I enhancer binding protein 2 | Hivep2 | S256 | AGLVPFTESSVS*K | NP_034567 | 0 | |||
hemicentin 1 | Hmcn1 | Y5591 | DENLKGVVY*TTRPLREAETYRMK | NP_001019891 | ||||
high mobility group AT-hook 1 | Hmga1 | S99, S102 | EEEEGIS*QES*SEEEQ | NP_001020598 | ||||
high mobility group AT-hook 1 | Hmga1 | S102, S103 | EEEEGISQES*S*EEEQ | NP_001020598 | ||||
high mobility group AT-hook 1 | Hmga1 | S102 | EEEEGISQES*SEEEQ | NP_001020598 | ||||
high mobility group AT-hook 1 | Hmga1 | S99 | KLEKEEEEGIS*QESSEEEQ | NP_001020598 | -0.03 | |||
high mobility group AT-hook 1 | Hmga1 | S102, S103 | KLEKEEEEGISQES*S*EEEQ | NP_001020598 | -0.13 | |||
high mobility group AT-hook 1 | Hmga1 | S102 | KLEKEEEEGISQES*SEEEQ | NP_001020598 | -0.03 | |||
high mobility group AT-hook 1 | Hmga1 | S103 | KLEKEEEEGISQESS*EEEQ | NP_001020598 | -0.03 | |||
high mobility group AT-hook 2 | Hmga2 | T99, S104 | KPAQETEET*SSQES*AEED | NP_034571 | -0.3 | |||
high mobility group AT-hook 2 | Hmga2 | T99 | KPAQETEET*SSQESAEED | NP_034571 | 0.07 | |||
high mobility group AT-hook 2 | Hmga2 | S100, S101 | KPAQETEETS*S*QESAEED | NP_034571 | 0.21 | |||
high mobility group AT-hook 2 | Hmga2 | S100, S104 | KPAQETEETS*SQES*AEED | NP_034571 | -0.41 | |||
high mobility group AT-hook 2 | Hmga2 | S101, S104 | KPAQETEETSS*QES*AEED | NP_034571 | -0.31 | |||
high mobility group AT-hook 2 | Hmga2 | S101 | KPAQETEETSS*QESAEED | NP_034571 | 0.04 | |||
high mobility group AT-hook 2 | Hmga2 | S104 | KPAQETEETSSQES*AEED | NP_034571 | -0.43 | |||
high mobility group AT-hook 2 | Hmga2 | S44 | KQQQEPTCEPS*PK | NP_034571 | -0.32 | |||
high mobility group box 2 | Hmgb2 | S14 | MS*SYAFFVQTCR | NP_032278 | ||||
high mobility group box 3 | Hmgb3 | T114 | ST*NPGISIGDVAK | NP_032279 | ||||
high mobility group nucleosomal binding domain 1 | Hmgn1 | T80, S87 | QADVADQQTTELPAENGET*ENQSPAS*EEEKEAK | NP_032277 | 0.06 | |||
high mobility group nucleosomal binding domain 1 | Hmgn1 | T80, S87, S95 | QADVADQQTTELPAENGET*ENQSPAS*EEEKEAKS*D | NP_032277 | -0.63 | |||
high mobility group nucleosomal binding domain 1 | Hmgn1 | T80 | QADVADQQTTELPAENGET*ENQSPASEEEK | NP_032277 | 0.48 | |||
high mobility group nucleosomal binding domain 1 | Hmgn1 | S84, S87 | QADVADQQTTELPAENGETENQS*PAS*EEEK | NP_032277 | -0.58 | |||
high mobility group nucleosomal binding domain 1 | Hmgn1 | S84, S87 | QADVADQQTTELPAENGETENQS*PAS*EEEKEAK | NP_032277 | -0.58 | |||
high mobility group nucleosomal binding domain 1 | Hmgn1 | S84 | QADVADQQTTELPAENGETENQS*PASEEEK | NP_032277 | 0.81 | |||
high mobility group nucleosomal binding domain 1 | Hmgn1 | S84 | QADVADQQTTELPAENGETENQS*PASEEEKEAK | NP_032277 | 0.21 | -0.24 | -0.48 | |
high mobility group nucleosomal binding domain 1 | Hmgn1 | S87 | QADVADQQTTELPAENGETENQSPAS*EEEK | NP_032277 | 0.52 | |||
high mobility group nucleosomal binding domain 1 | Hmgn1 | S87 | QADVADQQTTELPAENGETENQSPAS*EEEKEAK | NP_032277 | 1.06 | -0.5 | -0.54 | |
high mobility group nucleosomal binding domain 1 | Hmgn1 | S87 | QADVADQQTTELPAENGETENQSPAS*EEEKEAKSD | NP_032277 | -0.14 | |||
high mobility group nucleosomal binding domain 1 | Hmgn1 | S95 | QADVADQQTTELPAENGETENQSPASEEEKEAKS*D | NP_032277 | 0.71 | -0.32 | ||
HMG box domain containing 4 | Hmgxb4 | T352 | SSAREHGT*AR | NP_821136 | ||||
hematological and neurological expressed sequence 1 | Hn1 | S85 | S*NSSEASSGDFLDLK | NP_032284 | -0.1 | |||
hematological and neurological expressed sequence 1 | Hn1 | S87 | SNS*SEASSGDFLDLK | NP_032284 | 0.24 | |||
heterogeneous nuclear ribonucleoprotein A1 isoform b | Hnrnpa1 | S363 | NQGGYGGSSS*SSSYGSGR | NP_001034218 | 0.61 | |||
heterogeneous nuclear ribonucleoprotein A1 isoform b | Hnrnpa1 | S364 | NQGGYGGSSSS*SSYGSGR | NP_001034218 | 0.24 | |||
heterogeneous nuclear ribonucleoprotein A1 isoform b | Hnrnpa1 | S365 | NQGGYGGSSSSS*SYGSGR | NP_001034218 | -0.23 | |||
heterogeneous nuclear ribonucleoprotein A1 isoform b | Hnrnpa1 | S366 | NQGGYGGSSSSSS*YGSGR | NP_001034218 | -0.35 | |||
heterogeneous nuclear ribonucleoprotein A1 isoform b | Hnrnpa1 | S4 | S*ESPKEPEQLR | NP_001034218 | 0.23 | -0.05 | 1.03 | |
heterogeneous nuclear ribonucleoprotein A1 isoform b | Hnrnpa1 | S4 | S*ESPKEPEQLRK | NP_001034218 | 0.97 | |||
heterogeneous nuclear ribonucleoprotein A1 isoform b | Hnrnpa1 | S6 | SES*PKEPEQLR | NP_001034218 | 0.13 | -0.12 | -0.01 | |
heterogeneous nuclear ribonucleoprotein A1 isoform b | Hnrnpa1 | S6 | SES*PKEPEQLRK | NP_001034218 | 0.13 | -0.07 | ||
heterogeneous nuclear ribonucleoprotein A3 isoform c | Hnrnpa3 | S21 | LFIGGLS*FETTDDSLR | NP_444493 | -2.02 | |||
heterogeneous nuclear ribonucleoprotein A3 isoform c | Hnrnpa3 | S334 | S*SGSPYGGGYGSGGGSGGYGSR | NP_444493 | -0.17 | |||
heterogeneous nuclear ribonucleoprotein A3 isoform c | Hnrnpa3 | S335 | SS*GSPYGGGYGSGGGSGGYGSR | NP_444493 | -0.32 | -0.12 | 0.06 | |
heterogeneous nuclear ribonucleoprotein A3 isoform c | Hnrnpa3 | S337 | SSGS*PYGGGYGSGGGSGGYGSR | NP_444493 | -0.32 | -0.12 | -0.06 | |
heterogeneous nuclear ribonucleoprotein A3 isoform c | Hnrnpa3 | Y339 | SSGSPY*GGGYGSGGGSGGYGSR | NP_444493 | 0.04 | -0.02 | -0.13 | |
heterogeneous nuclear ribonucleoprotein A3 isoform c | Hnrnpa3 | Y343 | SSGSPYGGGY*GSGGGSGGYGSR | NP_444493 | 0.1 | |||
heterogeneous nuclear ribonucleoprotein C | Hnrnpc | S306 | DDEKEPEEGEDDRDS*ANGEDDS | NP_058580 | 0.3 | -0.08 | ||
heterogeneous nuclear ribonucleoprotein C | Hnrnpc | S268 | MESEAGADDS*AEEGDLLDDDDNEDRGDDQLELK | NP_058580 | 2.66 | |||
heterogeneous nuclear ribonucleoprotein C | Hnrnpc | S241 | NEKS*EEEQSSASVK | NP_058580 | -0.57 | |||
heterogeneous nuclear ribonucleoprotein C | Hnrnpc | S231 | QADLSFS*SPVEMK | NP_058580 | 0.08 | |||
heterogeneous nuclear ribonucleoprotein C | Hnrnpc | S232 | QADLSFSS*PVEMK | NP_058580 | 0.14 | |||
heterogeneous nuclear ribonucleoprotein C | Hnrnpc | S246 | SEEEQS*SASVKKDETNVK | NP_058580 | -0.04 | |||
heterogeneous nuclear ribonucleoprotein D isoform a | Hnrnpd | S80, S83 | IDASKNEEDEGHS*NSS*PR | NP_001070733 | -0.13 | |||
heterogeneous nuclear ribonucleoprotein D isoform a | Hnrnpd | S80 | IDASKNEEDEGHS*NSSPR | NP_001070733 | -0.09 | |||
heterogeneous nuclear ribonucleoprotein D isoform a | Hnrnpd | S82, S83 | IDASKNEEDEGHSNS*S*PR | NP_001070733 | -0.16 | |||
heterogeneous nuclear ribonucleoprotein D isoform a | Hnrnpd | S82 | IDASKNEEDEGHSNS*SPR | NP_001070733 | -0.19 | -0.07 | ||
heterogeneous nuclear ribonucleoprotein D isoform a | Hnrnpd | S83 | IDASKNEEDEGHSNSS*PR | NP_001070733 | 0.26 | -0.23 | ||
heterogeneous nuclear ribonucleoprotein H2 | Hnrnph2 | T100 | HT*GPNSPDTANDGFVR | NP_063921 | 0.18 | |||
heterogeneous nuclear ribonucleoprotein H2 | Hnrnph2 | S104 | HTGPNS*PDTANDGFVR | NP_063921 | 0.08 | -0.02 | ||
heterogeneous nuclear ribonucleoprotein H2 | Hnrnph2 | T107 | HTGPNSPDT*ANDGFVR | NP_063921 | 0.08 | 0.27 | ||
heterogeneous nuclear ribonucleoprotein K | Hnrnpk | S284 | DYDDMS*PR | NP_079555 | -0.38 | -0.23 | ||
heterogeneous nuclear ribonucleoprotein K | Hnrnpk | Y380 | GSY*GDLGGPIITTQVTIPK | NP_079555 | 2.53 | |||
heterogeneous nuclear ribonucleoprotein K | Hnrnpk | S216 | IILDLISES*PIK | NP_079555 | 0.12 | |||
heterogeneous nuclear ribonucleoprotein K | Hnrnpk | S116 | IIPTLEEGLQLPS*PTATSQLPLESDAVECLNYQHYK | NP_079555 | -0.1 | |||
heterogeneous nuclear ribonucleoprotein K | Hnrnpk | T118 | IIPTLEEGLQLPSPT*ATSQLPLESDAVECLNYQHYK | NP_079555 | -0.35 | |||
heterogeneous nuclear ribonucleoprotein K | Hnrnpk | S284 | RDYDDMS*PR | NP_079555 | -0.38 | -0.04 | -0.29 | |
heterogeneous nuclear ribonucleoprotein U | Hnrnpu | S247 | AKS*PQPPVEEEDEHFDDTVVCLDTYNCDLHFK | NP_058085 | 0.94 | |||
heterogeneous nuclear ribonucleoprotein U-like 2 | Hnrnpul2 | S183 | AVEEQGDDQDS*EKSKPAGSDGER | NP_001074665 | -0.26 | |||
heterogeneous nuclear ribonucleoprotein U-like 2 | Hnrnpul2 | S183 | AVEEQGDDQDS*EKSKPAGSDGERR | NP_001074665 | -0.54 | |||
heterogeneous nuclear ribonucleoprotein U-like 2 | Hnrnpul2 | S159 | S*GDETPGSEAPGDK | NP_001074665 | 0.03 | -0.11 | ||
heterogeneous nuclear ribonucleoprotein U-like 2 | Hnrnpul2 | S224 | S*KSPPPPEEEAKDEEEDQTLVNLDTYTSDLHFQISK | NP_001074665 | 1.06 | |||
heterogeneous nuclear ribonucleoprotein U-like 2 | Hnrnpul2 | S226 | SKS*PPPPEEEAKDEEEDQTLVNLDTYTSDLHFQISK | NP_001074665 | 1.03 | |||
heterogeneous nuclear ribonucleoprotein L-like | Hnrpll | S37 | LKTEEGEIVYS*AEESENR | NP_659051 | 0.28 | |||
Hermansky-Pudlak syndrome 6 | Hps6 | S14 | LLSDLS*NFTGAARLR | NP_789742 | ||||
hemopexin | Hpx | Y317 | VY*LIQGTQVYVFLTK | NP_059067 | ||||
heat shock factor 1 | Hsf1 | S303, S307 | VKQEPPS*PPHS*PR | NP_032322 | 0.38 | |||
heat shock protein 1, alpha | Hsp90aa1 | S231 | DKEVS*DDEAEEK | NP_034610 | 0.12 | |||
heat shock protein 1, alpha | Hsp90aa1 | S231 | DKEVS*DDEAEEKEEK | NP_034610 | -0.15 | |||
heat shock protein 1, alpha | Hsp90aa1 | S231 | DKEVS*DDEAEEKEEKEEEK | NP_034610 | 0.62 | -0.23 | ||
heat shock protein 1, alpha | Hsp90aa1 | S231 | DKEVS*DDEAEEKEEKEEEKEK | NP_034610 | ||||
heat shock protein 1, alpha | Hsp90aa1 | S231 | DKEVS*DDEAEEKEEKEEEKEKEEK | NP_034610 | 0.67 | |||
heat shock protein 1, alpha | Hsp90aa1 | S231 | ERDKEVS*DDEAEEKEEK | NP_034610 | -0.21 | |||
heat shock protein 1, alpha | Hsp90aa1 | S263 | ESDDKPEIEDVGS*DEEEEEK | NP_034610 | -0.22 | -0.01 | ||
heat shock protein 1, alpha | Hsp90aa1 | S263 | ESDDKPEIEDVGS*DEEEEEKK | NP_034610 | 0.37 | -0.17 | -0.1 | |
heat shock protein 1, alpha | Hsp90aa1 | S263 | ESDDKPEIEDVGS*DEEEEEKKDGDK | NP_034610 | 0.6 | -0.38 | ||
heat shock protein 1, alpha | Hsp90aa1 | S263 | ESDDKPEIEDVGS*DEEEEEKKDGDKK | NP_034610 | -0.41 | |||
heat shock protein 1, alpha | Hsp90aa1 | S263 | GS*DEEEEEKK | NP_034610 | ||||
heat shock protein 1, alpha | Hsp90aa1 | S454 | LGIHEDS*QNR | NP_034610 | ||||
heat shock protein 1, beta | Hsp90ab1 | S226 | EIS*DDEAEEEK | NP_032328 | 0.06 | |||
heat shock protein 1, beta | Hsp90ab1 | S226 | EKEIS*DDEAEEEK | NP_032328 | 0.11 | 0.17 | 0.02 | |
heat shock protein 1, beta | Hsp90ab1 | S226 | EKEIS*DDEAEEEKGEKEEEDKEDEEKPK | NP_032328 | 0.04 | |||
heat shock protein 1, beta | Hsp90ab1 | S255, S261 | IEDVGS*DEEDDS*GKDKK | NP_032328 | 0.05 | |||
heat shock protein 1, beta | Hsp90ab1 | S255 | IEDVGS*DEEDDSGK | NP_032328 | -0.08 | -0.18 | 0.01 | |
heat shock protein 1, beta | Hsp90ab1 | S255 | IEDVGS*DEEDDSGKDK | NP_032328 | 0.64 | 0 | -0.01 | |
heat shock protein 1, beta | Hsp90ab1 | S255 | IEDVGS*DEEDDSGKDKK | NP_032328 | 0.24 | -0.13 | ||
heat shock protein 1, beta | Hsp90ab1 | S255 | IEDVGS*DEEDDSGKDKKK | NP_032328 | -0.1 | |||
heat shock protein 1, beta | Hsp90ab1 | S261 | IEDVGSDEEDDS*GKDK | NP_032328 | 0.4 | |||
heat shock protein 1, beta | Hsp90ab1 | S261 | IEDVGSDEEDDS*GKDKK | NP_032328 | -0.05 | |||
heat shock protein 1, beta | Hsp90ab1 | S255 | KIEDVGS*DEEDDSGKDK | NP_032328 | ||||
heat shock protein 1, beta | Hsp90ab1 | S452 | RLS*ELLR | NP_032328 | 2.28 | |||
heat shock protein 1, beta | Hsp90ab1 | T94 | TLTLVDTGIGMT*K | NP_032328 | ||||
heat shock 70kDa protein 1-like | Hspa1l | T68 | NQVAMNPQNT*VFDAK | NP_038586 | ||||
heat shock protein 2 | Hspa2 | S224 | S*TAGDTHLGGEDFDNR | NP_001002012 | ||||
heat shock protein 4 | Hspa4 | S76 | AFS*DPFVEAEK | NP_032326 | 0.42 | |||
heat shock protein 9 | Hspa9 | S638 | QAAS*SLQQASLK | NP_034611 | ||||
heat shock 105kD | Hsph1 | S810 | IES*PKLER | NP_038587 | 0.05 | -0.16 | -0.18 | |
HECT, UBA and WWE domain containing 1 | Huwe1 | S2919 | ESNQPPEDSS*PPASSESSSTR | NP_067498 | 0.1 | |||
HECT, UBA and WWE domain containing 1 | Huwe1 | T3132, S3133, T3144 | SPAFT*S*RLSGNRGVQYT*RLAVQR | NP_067498 | ||||
islet amyloid polypeptide | Iapp | T24 | AT*PVRSGSNPQMDKRK | NP_034621 | ||||
inhibitor of Bruton's tyrosine kinase | Ibtk | Y178 | HHPELLDLFSRSGVY*VK | NP_001074751 | ||||
isoprenylcysteine carboxyl methyltransferase | Icmt | T272 | VPT*GLPFIK | NP_598549 | ||||
carnitine deficiency-associated gene expressed in ventricle 1 | Ift81 | T61 | EEMPEQT*AKR | NP_034009 | 9999 | |||
insulin-like growth factor 2 mRNA binding protein 1 | Igf2bp1 | S181 | QGS*PVAAGAPAK | NP_034081 | -0.18 | |||
insulin-like growth factor 2 mRNA binding protein 2 | Igf2bp2 | S161 | ISYIPDEEVS*SPSPPHR | NP_898850 | 0.31 | |||
insulin-like growth factor 2 mRNA binding protein 2 | Igf2bp2 | S162 | ISYIPDEEVSS*PSPPHR | NP_898850 | -0.14 | |||
insulin-like growth factor 2 mRNA binding protein 2 | Igf2bp2 | S164 | ISYIPDEEVSSPS*PPHR | NP_898850 | -0.13 | |||
insulin-like growth factor 2 receptor | Igf2r | S2393 | AEALSS*LHGDDQDSEDEVLTVPEVK | NP_034645 | 0.61 | |||
insulin-like growth factor 2 receptor | Igf2r | S2401 | AEALSSLHGDDQDS*EDEVLTVPEVK | NP_034645 | 0.46 | |||
insulin-like growth factor 2 receptor | Igf2r | S2476 | LVSFHDDS*DEDLLHI | NP_034645 | ||||
inhibitor of nuclear factor kappa B kinase beta subunit isoform 1 | Ikbkb | S466 | NNSCLS*KMKNAMASTAQQLKAK | NP_001153246 | ||||
helios | Ikzf2 | S278 | RKS*STPQKFVGEK | NP_035900 | ||||
interleukin 28 receptor alpha | Il28ra | S389, S392, T393 | S*WSS*T*GDSSYK | NP_777276 | -3.4 | |||
imprinted and ancient | Impact | Y206, S213, T215, Y219, Y221 | LVLAKLY*ENKKIAS*AT*HNIY*AY*R | NP_032404 | ||||
InaD-like isoform 2 | Inadl | S455 | KTS*LSASPFEHSSSR | NP_001005784 | 0.93 | -3.86 | ||
InaD-like isoform 2 | Inadl | S647 | RLFDDEAS*VDEPR | NP_001005784 | 0.02 | |||
InaD-like isoform 1 | Inadl | S1215 | APS*ADMEGSEEDCALTDKK | NP_766284 | -0.04 | |||
INO80 complex subunit C | Ino80c | T178, Y180 | RLPSDVVT*GY*LALRK | NP_766213 | ||||
inositol polyphosphate-4-phosphatase, type 1 isoform 1 | Inpp4a | S219 | KDS*LLKAVFGGAICRMYR | NP_084542 | ||||
inositol polyphosphate-5-phosphatase F | Inpp5f | S906 | S*QSASSIDVSTHAPSEAAAGPGSELGK | NP_848756 | ||||
integrator complex subunit 1 | Ints1 | S1328 | DSTEAPKPES*SPEPPPGQGR | NP_081024 | 0.23 | |||
integrator complex subunit 1 | Ints1 | S1329 | DSTEAPKPESS*PEPPPGQGR | NP_081024 | 0.44 | |||
integrator complex subunit 1 | Ints1 | S1320, S1328 | RDS*TEAPKPES*SPEPPPGQGR | NP_081024 | -0.32 | |||
integrator complex subunit 1 | Ints1 | S1320, S1329 | RDS*TEAPKPESS*PEPPPGQGR | NP_081024 | 1.33 | |||
integrator complex subunit 1 | Ints1 | S1320 | RDS*TEAPKPESSPEPPPGQGR | NP_081024 | -0.37 | |||
integrator complex subunit 12 | Ints12 | S375, S377 | S*VS*CDNVSK | NP_082203 | ||||
integrator complex subunit 3 | Ints3 | S500 | EKFPEFCSSPS*PPVEVK | NP_663515 | 0.31 | |||
importin 5 | Ipo5 | S578 | EKFMQDAS*DVMQLLLK | NP_076068 | -5.85 | |||
IQ calmodulin-binding motif containing 1 | Iqcb1 | S443 | KKKLFAS*W | NP_796102 | ||||
interferon regulatory factor 2 binding protein 1 | Irf2bp1 | S453 | AGGAS*PAASSTTQPPAQHR | NP_848872 | -0.28 | 0.09 | -0.07 | |
interferon regulatory factor 2 binding protein 1 | Irf2bp1 | S436 | NVAEALGHS*PKDPGGGGGSVR | NP_848872 | -0.4 | -0.29 | ||
PREDICTED: similar to interferon regulatory factor 2 binding protein 2 | Irf2bp2 | S362 | LEEPPELNRQS*PNPR | XP_001002526 | 0.45 | |||
PREDICTED: similar to interferon regulatory factor 2 binding protein 2 | Irf2bp2 | S633, S636 | NSSS*PPS*PSSMNQR | XP_001002526 | 0.4 | |||
PREDICTED: similar to interferon regulatory factor 2 binding protein 2 | Irf2bp2 | S633, S638 | NSSS*PPSPS*SMNQR | XP_001002526 | 0.43 | |||
PREDICTED: similar to interferon regulatory factor 2 binding protein 2 | Irf2bp2 | S536 | RKPS*PEPEGEVGPPK | XP_001002526 | 0.23 | -0.34 | ||
PREDICTED: similar to interferon regulatory factor 2 binding protein 2 isoform 1 | Irf2bp2 | S71 | S*PTGAQPAAAKPPPLSAK | XP_284454 | ||||
PREDICTED: similar to interferon regulatory factor 2 binding protein 2 isoform 1 | Irf2bp2 | T73 | SPT*GAQPAAAKPPPLSAK | XP_284454 | ||||
interferon regulatory factor 3 | Irf3 | S135 | SSLPHS*QENLPK | NP_058545 | 0.03 | |||
insulin receptor substrate 2 | Irs2 | S1165 | HNSAS*VENVSLR | NP_001074681 | 1.12 | |||
insulin receptor substrate 2 | Irs2 | S556 | RVS*GDGAQDLDR | NP_001074681 | 2.4 | |||
insulin receptor substrate 2 | Irs2 | S303 | SKS*QSSGSSATHPISVPGAR | NP_001074681 | ||||
insulin receptor substrate 2 | Irs2 | T360 | T*ASEGDGGAAGGAGTAGGR | NP_001074681 | ||||
insulin receptor substrate 2 | Irs2 | S362 | TAS*EGDGGAAGGAGTAGGR | NP_001074681 | -0.32 | |||
insulin receptor substrate 4 | Irs4 | S1059, S1063, T1064 | RPQSRSQS*LFAS*T*R | NP_034702 | ||||
nitrogen fixation cluster-like | Iscu | S15 | AAS*ALLLR | NP_079802 | -0.03 | |||
nitrogen fixation cluster-like | Iscu | S15 | RAAS*ALLLR | NP_079802 | 0.14 | |||
integrin alpha 2 | Itga2 | T664, T673 | IT*LLNKDAKIT*LK | NP_032422 | ||||
integrin alpha 9 isoform a | Itga9 | S412 | VPKYS*MKLSGR | NP_598482 | ||||
inositol 1,4,5-triphosphate receptor 3 | Itpr3 | S1832 | VSS*FSMPSSSR | NP_542120 | 2.6 | |||
IWS1 homolog | Iws1 | S343, S345 | AAVLS*DS*EDDAGNASAK | NP_775617 | 0.11 | |||
IWS1 homolog | Iws1 | S321 | IDS*DDDEEKEGDEEK | NP_775617 | -0.06 | |||
IWS1 homolog | Iws1 | S321 | IDS*DDDEEKEGDEEKVAK | NP_775617 | 0.05 | |||
IWS1 homolog | Iws1 | S667 | LSS*TGGQTPR | NP_775617 | -3.1 | |||
IWS1 homolog | Iws1 | S321 | QKIDS*DDDEEKEGDEEK | NP_775617 | -0.27 | |||
PREDICTED: janus kinase and microtubule interacting protein 2 isoform 1 | Jakmip2 | S202 | WES*ERDIR | XP_129010 | 10.83 | |||
Jun oncogene | Jun | S73 | LAS*PELER | NP_034721 | -0.45 | 0.17 | -0.61 | |
Jun-B oncogene | Junb | T252, S256 | SRDAT*PPVS*PINMEDQER | NP_032442 | -2.04 | |||
junction plakoglobin | Jup | S182 | ALMGS*PQLVAAVVR | NP_034723 | 0.04 | |||
junction plakoglobin | Jup | S665 | KRVS*VELTNSLFK | NP_034723 | -0.29 | |||
junction plakoglobin | Jup | S665 | RVS*VELTNSLFK | NP_034723 | 1.76 | |||
PREDICTED: similar to kalirin, RhoGEF kinase | Kalrn | S2343 | KPKDILGNKVS*VK | XP_001001454 | ||||
KN motif and ankyrin repeat domains 1 | Kank1 | S70 | RKPS*VPCPEVR | NP_852069 | 3.71 | |||
KN motif and ankyrin repeat domains 3 | Kank3 | S256, S265 | LATS*DRGVRSRAS*PR | NP_109622 | ||||
general control of amino acid synthesis 5-like 2 isoform b | Kat2a | T433 | KLPENLT*LEDAKRLR | NP_001033099 | ||||
kelch repeat and BTB (POZ) domain containing 7 | Kbtbd7 | S190 | LRS*QAQSFIAHNFK | NP_001019306 | ||||
potassium inwardly-rectifying channel J10 | Kcnj10 | S345, T346 | DS*T*VRYGDPEKLK | NP_001034573 | ||||
potassium inwardly-rectifying channel J16 | Kcnj16 | S6 | MSYYGS*SYR | NP_034734 | ||||
potassium channel, subfamily T, member 2 | Kcnt2 | Y944, Y959 | LY*QKLCSSTGDVPIGIY*RTESQK | NP_001074496 | ||||
potassium channel tetramerization domain-containing 10 isoform 1 | Kctd10 | S11, S12, S23 | MEEMSGDSVVS*S*AVPAAATRTTS*FKGASPSSK | NP_001153413 | ||||
jumonji, AT rich interactive domain 1D (Rbp2 like) | Kdm5d | Y143, S151 | VAQRLNY*PSGKNIGS*LLR | NP_035549 | -2.54 | |||
KH domain containing, RNA binding, signal transduction associated 1 | Khdrbs1 | T317, S322 | GALVRGT*PVRGS*ITR | NP_035447 | ||||
KH domain containing, RNA binding, signal transduction associated 1 | Khdrbs1 | S18 | S*CSKDPSGAHPSVR | NP_035447 | -0.5 | |||
KH domain containing, RNA binding, signal transduction associated 1 | Khdrbs1 | S20 | SCS*KDPSGAHPSVR | NP_035447 | -0.45 | |||
KH-type splicing regulatory protein | Khsrp | S182 | VQIS*PDSGGLPER | NP_034743 | -2.06 | |||
kinesin family member 11 | Kif11 | T925 | LDIPTGMT*PER | NP_034745 | -7.52 | |||
kinesin family member 13B | Kif13b | T1653 | APLLSEPASAVPT*SPFR | NP_001074646 | -1.87 | |||
kinesin family member 13B | Kif13b | S1654 | APLLSEPASAVPTS*PFR | NP_001074646 | -1.83 | -1.89 | -2.84 | * |
kinesin family member 13B | Kif13b | S1409 | GRWES*QQDVSQTLVSR | NP_001074646 | 0.41 | -0.55 | ||
kinesin family member 13B | Kif13b | T1704 | LEVT*SDSEDASEVPEWLR | NP_001074646 | 0.07 | |||
kinesin family member 13B | Kif13b | S1705 | LEVTS*DSEDASEVPEWLR | NP_001074646 | 0.09 | |||
kinesin family member 13B | Kif13b | S1388 | LS*GSRQELSPSHSLGSNK | NP_001074646 | ||||
kinesin family member 13B | Kif13b | S1390 | LSGS*RQELSPSHSLGSNK | NP_001074646 | -0.38 | |||
kinesin family member 13B | Kif13b | S1395 | LSGSRQELS*PSHSLGSNK | NP_001074646 | ||||
kinesin family member 13B | Kif13b | S1794, S1795 | RRS*S*GLQPQGAPEVR | NP_001074646 | 5.73 | |||
kinesin family member 13B | Kif13b | S1380 | RSIS*SPSMNR | NP_001074646 | ||||
kinesin family member 13B | Kif13b | S1794 | S*SGLQPQGAPEVR | NP_001074646 | 0.74 | 1.72 | ||
kinesin family member 13B | Kif13b | S1380 | SIS*SPSMNR | NP_001074646 | -0.16 | 0.28 | -0.17 | |
kinesin family member 13B | Kif13b | S1795 | SS*GLQPQGAPEVR | NP_001074646 | 0.14 | 0.74 | 1.04 | |
kinesin family member 13B | Kif13b | S1409 | WES*QQDVSQTLVSR | NP_001074646 | 0.34 | -0.35 | ||
kinesin family member 14 | Kif14 | S614, T617 | EGVSINKS*LLT*LGK | NP_001074727 | 5.28 | |||
kinesin family member 15 | Kif15 | T440, T446 | SLIEKIT*QLEDLT*LK | NP_034750 | ||||
kinesin family member 16B | Kif16b | T33, T34, T36 | SKT*T*IT*NLK | NP_001074602 | ||||
kinesin family member 17 | Kif17 | Y424 | LKADY*EAEQESRVR | NP_034753 | >10 | |||
M-phase phosphoprotein 1 | Kif20b | T1374 | FKDLET*R | NP_898867 | -0.28 | |||
M-phase phosphoprotein 1 | Kif20b | S1612, T1629 | S*GEVEEDLVKCENKKNST*PR | NP_898867 | ||||
kinesin family member 24 | Kif24 | T1169, S1174, T1176 | AEET*ELGGS*LT*FPR | NP_077203 | <-10 | |||
kinesin family member 5C | Kif5c | S609, S621 | SKQLES*AQMDSNRKMNAS*ER | NP_032475 | ||||
killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2 | Kir3dl2 | S7 | MLLWFLS*LMCSGFFLVQR | NP_808416 | -6.39 | |||
kinesin light chain 2 | Klc2 | S579 | ASS*LNFLNK | NP_032477 | 0.05 | 0.46 | 0.31 | |
kinesin light chain 3 | Klc3 | S467 | AMS*LNMLNVDGPR | NP_666294 | 0.25 | 0.16 | ||
kinesin light chain 3 | Klc3 | S501 | TLSIS*TQDLSPR | NP_666294 | 0.31 | 0.61 | -0.24 | |
kinesin light chain 4 | Klc4 | S590 | AAS*LNYLNQPNAAPLQVSR | NP_083367 | 0.04 | -0.62 | ||
kinesin light chain 4 | Klc4 | S611 | GLSAS*TVDLSSSS | NP_083367 | ||||
kinesin light chain 4 | Klc4 | T612 | GLSAST*VDLSSSS | NP_083367 | ||||
kinesin light chain 4 | Klc4 | S566 | RSS*ELLVR | NP_083367 | 0.92 | |||
Kruppel-like factor 3 (basic) | Klf3 | S71, S80 | GS*PPAAGGSPS*SLK | NP_032479 | 0.1 | |||
Kruppel-like factor 3 (basic) | Klf3 | S71 | GS*PPAAGGSPSSLK | NP_032479 | 0.16 | |||
Kruppel-like factor 3 (basic) | Klf3 | S78 | GSPPAAGGS*PSSLK | NP_032479 | ||||
Kruppel-like factor 3 (basic) | Klf3 | S91, S99 | RAS*PGLSMPSS*SPPIKK | NP_032479 | 0.38 | |||
Kruppel-like factor 3 (basic) | Klf3 | S249 | RPLPVES*PDTQR | NP_032479 | 0.55 | 0.74 | ||
kallikrein 1 | Klk1b1 | T193 | VT*DVMLCAGVK | NP_034775 | ||||
kallikrein related-peptidase 6 | Klk6 | Y98, S119 | Y*NPETHDNDIMMVHLKNPVKFS*K | NP_035307 | ||||
kininogen 2 isoform 3 | Kng2 | T401 | VQETKAGTT*K | NP_001095880 | -24.7 | <-10 | ||
kinetochore associated 1 | Kntc1 | S632 | WLEQAS*R | NP_001035886 | -3.84 | |||
karyopherin (importin) alpha 3 | Kpna3 | S60 | NVPQEESLEDS*DVDADFK | NP_032492 | -0.2 | |||
KRI1 homolog | Kri1 | S142 | YVDEDNS*DGETVDHR | NP_663391 | -0.28 | |||
KRI1 homolog | Kri1 | T146 | YVDEDNSDGET*VDHR | NP_663391 | ||||
keratin complex 2, basic, gene 1 | Krt1 | S598, Y599, S610 | GGSGGGGGSSGGS*Y*GGSSGGGRGGS*SSGGGGVK | NP_032499 | ||||
keratin complex 1, acidic, gene 10 | Krt10 | S148 | LAS*YMDK | NP_034790 | ||||
keratin 13 | Krt13 | S427, S429 | GSPSS*NS*GRPDFR | NP_034792 | ||||
keratin 18 | Krt18 | S170 | QS*VESDIHGLR | NP_034794 | ||||
keratin 18 | Krt18 | S7 | S*TTFSTNYR | NP_034794 | 0.26 | 0.37 | -0.24 | |
keratin 18 | Krt18 | T8 | ST*TFSTNYR | NP_034794 | 0.53 | -0.03 | -0.61 | |
keratin 18 | Krt18 | T9 | STT*FSTNYR | NP_034794 | -0.61 | |||
keratin 18 | Krt18 | S31, S32 | VRPAS*S*AASVYAGAGGSGSR | NP_034794 | -0.5 | |||
keratin 18 | Krt18 | S31, S35 | VRPAS*SAAS*VYAGAGGSGSR | NP_034794 | -0.5 | |||
keratin 18 | Krt18 | S31, S43 | VRPAS*SAASVYAGAGGS*GSR | NP_034794 | -0.13 | |||
keratin 18 | Krt18 | S31 | VRPAS*SAASVYAGAGGSGSR | NP_034794 | 0.84 | 0.01 | -0.39 | |
keratin 18 | Krt18 | S32, S43 | VRPASS*AASVYAGAGGS*GSR | NP_034794 | -0.14 | |||
keratin 18 | Krt18 | S32 | VRPASS*AASVYAGAGGSGSR | NP_034794 | -0.67 | 0.02 | -0.37 | |
keratin 18 | Krt18 | S35, Y37 | VRPASSAAS*VY*AGAGGSGSR | NP_034794 | -0.14 | |||
keratin 18 | Krt18 | S35 | VRPASSAAS*VYAGAGGSGSR | NP_034794 | 0.08 | 0.01 | -0.39 | |
keratin 18 | Krt18 | Y37 | VRPASSAASVY*AGAGGSGSR | NP_034794 | -0.28 | |||
keratin 18 | Krt18 | S43 | VRPASSAASVYAGAGGS*GSR | NP_034794 | 0.04 | -0.29 | -0.89 | |
keratin 18 | Krt18 | S45 | VRPASSAASVYAGAGGSGS*R | NP_034794 | -0.36 | -0.36 | ||
keratin 19 | Krt19 | S27 | IGS*GGVFR | NP_032497 | 0.29 | |||
keratin 19 | Krt19 | T399 | SLLEGQEAHYNNLPT*PK | NP_032497 | -0.67 | |||
keratin 20 | Krt20 | S11 | S*LSSSSQGPALSMSGSLYR | NP_075745 | -1.11 | |||
keratin 20 | Krt20 | S13 | SLS*SSSQGPALSMSGSLYR | NP_075745 | -0.59 | |||
keratin 20 | Krt20 | S430 | VVSSEVKEIEES*V | NP_075745 | -1.07 | |||
keratin 5 | Krt5 | S392 | LRS*EIDNVKK | NP_081287 | ||||
keratin 7 | Krt7 | S32 | S*LYGLGSSR | NP_149064 | 0.06 | 0.07 | ||
keratin 7 | Krt7 | S32 | S*LYGLGSSRPR | NP_149064 | -0.07 | 0.04 | ||
keratin 7 | Krt7 | Y34 | SLY*GLGSSRPR | NP_149064 | ||||
keratin 7 | Krt7 | S39 | SLYGLGSS*RPR | NP_149064 | ||||
keratin 73 | Krt73 | S248 | KDVDAAYMS*K | NP_997650 | ||||
keratin 74 | Krt74 | S233 | VDS*LDK | NP_001003669 | 0.34 | |||
keratin complex 2, basic, gene 8 | Krt8 | S35 | ISS*SSFSR | NP_112447 | 0.16 | |||
keratin complex 2, basic, gene 8 | Krt8 | S36 | ISSS*SFSR | NP_112447 | 0.3 | |||
keratin complex 2, basic, gene 8 | Krt8 | S37 | ISSSS*FSR | NP_112447 | 0.02 | 1.99 | -0.01 | |
keratin complex 2, basic, gene 8 | Krt8 | S39 | ISSSSFS*R | NP_112447 | 0.02 | |||
keratin complex 2, basic, gene 8 | Krt8 | S485 | LVSESS*DVVSK | NP_112447 | -0.22 | -0.22 | ||
keratin complex 2, basic, gene 8 | Krt8 | S489 | LVSESSDVVS*K | NP_112447 | -2.17 | -0.32 | -0.28 | |
keratin complex 2, basic, gene 8 | Krt8 | S24 | S*FTSGPGAR | NP_112447 | 0.16 | -0.06 | 0.05 | |
keratin complex 2, basic, gene 8 | Krt8 | T26 | SFT*SGPGAR | NP_112447 | 0.05 | -0.03 | ||
keratin complex 2, basic, gene 8 | Krt8 | S27 | SFTS*GPGAR | NP_112447 | ||||
keratin complex 2, basic, gene 8 | Krt8 | S46 | VGSSSS*SFR | NP_112447 | -0.23 | |||
keratin complex 2, basic, gene 8 | Krt8 | S47 | VGSSSSS*FR | NP_112447 | -0.07 | |||
keratin 82 | Krt82 | S131 | FAS*FINKVR | NP_444479 | ||||
keratin complex 1, acidic, gene 9 | Krt9 | S487, S495, S498, Y499, S503, S506 | S*GGSYGGGS*GGS*Y*GGGS*GGS*HGGK | NP_957707 | -8.1 | |||
kinectin 1 | Ktn1 | S75 | EIQNGTLRES*DSEHVPR | NP_032503 | 0.69 | 0.05 | ||
kinectin 1 | Ktn1 | S77 | EIQNGTLRESDS*EHVPR | NP_032503 | 0.7 | |||
l(3)mbt-like | L3mbtl | T644 | FT*AHHCLSGCPLAEKNQSRLK | NP_001074807 | ||||
ladinin | Lad1 | S328 | ALPDKS*PPSSAEQSTPAPPTK | NP_598425 | -1.2 | 0.78 | ||
ladinin | Lad1 | S331 | ALPDKSPPS*SAEQSTPAPPTK | NP_598425 | -2.5 | |||
ladinin | Lad1 | S332 | ALPDKSPPSS*AEQSTPAPPTK | NP_598425 | -0.18 | |||
ladinin | Lad1 | S521, S523 | AQWGSKPS*TS*LDAEV | NP_598425 | 0.91 | |||
ladinin | Lad1 | T522, S523 | AQWGSKPST*S*LDAEV | NP_598425 | 0.89 | |||
ladinin | Lad1 | S523 | AQWGSKPSTS*LDAEV | NP_598425 | 0 | 0.18 | ||
ladinin | Lad1 | S358 | IPS*KDEDADTPSPTLLTY | NP_598425 | -0.83 | |||
ladinin | Lad1 | S358 | IPS*KDEDADTPSPTLLTYSSSLKR | NP_598425 | 0.52 | |||
ladinin | Lad1 | S367 | IPSKDEDADTPS*PTLLTY | NP_598425 | -1.84 | |||
ladinin | Lad1 | S62 | LPS*VEEAEVSKPSPPASK | NP_598425 | -0.28 | 0.16 | ||
ladinin | Lad1 | S62 | LPS*VEEAEVSKPSPPASKDEDEDFQAILR | NP_598425 | 0.06 | -0.13 | ||
ladinin | Lad1 | S38 | NLS*STTDDESPK | NP_598425 | 0.42 | |||
ladinin | Lad1 | T19 | QRT*LEDEEEQER | NP_598425 | -0.9 | 0.51 | ||
ladinin | Lad1 | T19 | QRT*LEDEEEQERER | NP_598425 | ||||
laminin, gamma 2 | Lamc2 | S1051 | GLATLKS*EMREMEGELAR | NP_032511 | ||||
la related protein | Larp1 | T503 | AVT*PVPTK | NP_082727 | -0.47 | |||
la related protein | Larp1 | S81 | ESPRPPAAAEAPAGS*DGEDGGRR | NP_082727 | 0.06 | |||
la related protein | Larp1 | T626 | ILIVTQT*PPYMR | NP_082727 | -0.25 | |||
la related protein | Larp1 | S743, S751 | S*LPTTVPES*PNYR | NP_082727 | 0.64 | |||
la related protein | Larp1 | S743, Y754 | S*LPTTVPESPNY*R | NP_082727 | ||||
la related protein | Larp1 | S751 | SLPTTVPES*PNYR | NP_082727 | -0.65 | -0.29 | -0.4 | |
La ribonucleoprotein domain family, member 4 isoform 1 | Larp4 | S578 | DTLNPVAVPVS*SPTATKPSPANTASPCTSNINPPR | NP_001019697 | 0.73 | |||
La ribonucleoprotein domain family, member 4 isoform 1 | Larp4 | T583 | DTLNPVAVPVSSPTAT*KPSPANTASPCTSNINPPR | NP_001019697 | ||||
La ribonucleoprotein domain family, member 4 isoform 1 | Larp4 | S717 | EQYVPPRS*PK | NP_001019697 | -0.84 | |||
La ribonucleoprotein domain family, member 4 isoform 1 | Larp4 | S128 | KQLEFCFS*R | NP_001019697 | 4.29 | |||
La ribonucleoprotein domain family, member 5 | Larp5 | S500 | KNS*FGYR | NP_766173 | 0.98 | |||
La ribonucleoprotein domain family, member 5 | Larp5 | T735, S739 | LSKEQNT*PPKS*PQ | NP_766173 | -0.14 | |||
La ribonucleoprotein domain family, member 5 | Larp5 | S603 | SPS*PVHLPEDPK | NP_766173 | 0.1 | |||
La ribonucleoprotein domain family, member 7 | Larp7 | T251, S256 | T*ASEGS*EAETPEAPK | NP_613059 | 0.22 | |||
La ribonucleoprotein domain family, member 7 | Larp7 | T251, S256 | T*ASEGS*EAETPEAPKQPAK | NP_613059 | 0.12 | |||
La ribonucleoprotein domain family, member 7 | Larp7 | S253, S256 | TAS*EGS*EAETPEAPK | NP_613059 | 0.39 | 0.04 | ||
La ribonucleoprotein domain family, member 7 | Larp7 | S253, S256 | TAS*EGS*EAETPEAPKQPAK | NP_613059 | 0.08 | |||
La ribonucleoprotein domain family, member 7 | Larp7 | S253 | TAS*EGSEAETPEAPK | NP_613059 | -0.53 | |||
large tumor supressor, homolog 1 | Lats1 | S278 | RYS*GNMEYVISR | NP_034820 | ||||
PREDICTED: lupus brain antigen 1 | Lba1 | Y1371 | MIKGRSSY*NPALIWK | XP_001481117 | <-10 | |||
leucine carboxyl methyltransferase 1 | Lcmt1 | S247 | RRS*CDLAGVETCK | NP_079580 | 1.82 | |||
leucine carboxyl methyltransferase 1 | Lcmt1 | S247 | S*CDLAGVETCK | NP_079580 | 1.47 | 2.4 | 1.82 | * |
LIM domain binding 1 isoform 1 | Ldb1 | S302 | MS*GGSTMSSGGGNTNNSNSK | NP_001106879 | 0.2 | |||
L-lactate dehydrogenase A isoform 2 | Ldha | S38 | ITVVGVGAVGMACAIS*ILMK | NP_001129541 | ||||
L-lactate dehydrogenase A isoform 2 | Ldha | T144, Y145 | LLIVSNPVDILT*Y*VAW | NP_001129541 | ||||
L-lactate dehydrogenase A isoform 2 | Ldha | S237 | QVVDS*AYEVIK | NP_001129541 | ||||
leukocyte cell-derived chemotaxin 2 | Lect2 | Y110, S113 | GFCVKIFYIKPIKY*KGS*IK | NP_034832 | ||||
LEM domain containing 2 | Lemd2 | S507 | WTKPSSFS*DSER | NP_666187 | 1.36 | 0.25 | ||
LEM domain containing 2 | Lemd2 | S509 | WTKPSSFSDS*ER | NP_666187 | 1.2 | 0.18 | ||
Leo1, Paf1/RNA polymerase II complex component, homolog | Leo1 | S659 | KYVIS*DEEEEEDD | NP_001034611 | -0.08 | |||
Leo1, Paf1/RNA polymerase II complex component, homolog | Leo1 | Y656 | Y*VISDEEEEEDD | NP_001034611 | ||||
Leo1, Paf1/RNA polymerase II complex component, homolog | Leo1 | S659 | YVIS*DEEEEEDD | NP_001034611 | ||||
DNA ligase I | Lig1 | T202 | EGDQLIVPSEPT*KSPESVTLTK | NP_001076657 | -0.16 | |||
DNA ligase I | Lig1 | S204 | EGDQLIVPSEPTKS*PESVTLTK | NP_001076657 | -0.14 | |||
DNA ligase I | Lig1 | T93 | KVAQVLSCEGEDEDEAPGT*PK | NP_001076657 | 0 | -1.41 | ||
DNA ligase I | Lig1 | S65 | NQVVPES*DSPVKR | NP_001076657 | -0.76 | -0.36 | ||
DNA ligase I | Lig1 | S67 | NQVVPESDS*PVKR | NP_001076657 | 0.05 | 0.17 | ||
DNA ligase I | Lig1 | T93 | VAQVLSCEGEDEDEAPGT*PK | NP_001076657 | 0.09 | |||
LIM domain and actin binding 1 isoform a | Lima1 | S615 | KGWS*ESEQSEEFGGGIATMER | NP_001107017 | 0.43 | |||
LIM domain and actin binding 1 isoform a | Lima1 | S617 | KGWSES*EQSEEFGGGIATMER | NP_001107017 | 0.83 | |||
LIM domain and actin binding 1 isoform a | Lima1 | S620 | KGWSESEQS*EEFGGGIATMER | NP_001107017 | 0.43 | |||
LIM domain and actin binding 1 isoform a | Lima1 | S488 | PAQPPNAGESPHS*PGVEDAPIAK | NP_001107017 | -0.2 | -0.01 | 0.22 | |
LIM domain and actin binding 1 isoform a | Lima1 | S225 | RLS*ENNCSLDDWEIGAGHLSSSAFNSEK | NP_001107017 | 0.81 | |||
LIM domain and actin binding 1 isoform a | Lima1 | S15 | RQWTSLS*LR | NP_001107017 | ||||
LIM domain and actin binding 1 isoform a | Lima1 | S467, S485 | S*DNEETLGRPAQPPNAGES*PHSPGVEDAPIAK | NP_001107017 | -1.27 | |||
LIM domain and actin binding 1 isoform a | Lima1 | S485 | SDNEETLGRPAQPPNAGES*PHSPGVEDAPIAK | NP_001107017 | ||||
LIM domain and actin binding 1 isoform a | Lima1 | S488 | SDNEETLGRPAQPPNAGESPHS*PGVEDAPIAK | NP_001107017 | 0.37 | -0.36 | ||
LIM domain and actin binding 1 isoform a | Lima1 | S367 | TSS*LPESSPSK | NP_001107017 | -0.62 | -0.96 | 0.26 | |
LIM domain and actin binding 1 isoform a | Lima1 | S372 | TSSLPESS*PSK | NP_001107017 | -0.61 | |||
LIM and calponin homology domains 1 | Limch1 | S231 | GS*DSESDLPHR | NP_001001980 | ||||
LIM and calponin homology domains 1 | Limch1 | S231 | GSSDGRGS*DSESDLPHR | NP_001001980 | -0.01 | |||
LIM and calponin homology domains 1 | Limch1 | S719 | S*PEPEATLTFPFLDK | NP_001001980 | -0.64 | |||
LIM and calponin homology domains 1 | Limch1 | S212, S217 | S*RQTPS*PDVVLR | NP_001001980 | ||||
LIM and calponin homology domains 1 | Limch1 | T215, S217 | SRQT*PS*PDVVLR | NP_001001980 | -0.14 | |||
LIM and calponin homology domains 1 | Limch1 | S973 | TINHQMES*PGER | NP_001001980 | -2.35 | -2.05 | ||
LIM and calponin homology domains 1 | Limch1 | S719 | VAKPKS*PEPEATLTFPFLDK | NP_001001980 | -0.87 | -0.35 | ||
limb expression 1 | Lix1 | S102, S109 | AEARRDAAKVALINS*LFNELPS*R | NP_079957 | ||||
lethal giant larvae homolog 2 | Llgl2 | S1022 | VAVGCRLS*NGEAE | NP_663413 | -0.01 | |||
lamin A isoform A | Lmna | S390, S392 | LRLS*PS*PTSQR | NP_001002011 | -0.51 | 0.36 | ||
lamin A isoform A | Lmna | S390, S395 | LRLS*PSPTS*QR | NP_001002011 | 0.38 | |||
lamin A isoform A | Lmna | S390 | LRLS*PSPTSQR | NP_001002011 | -0.51 | -0.06 | -0.02 | |
lamin A isoform A | Lmna | S392 | LRLSPS*PTSQR | NP_001002011 | -0.01 | 0.6 | -0.03 | |
lamin A isoform A | Lmna | T394 | LRLSPSPT*SQR | NP_001002011 | ||||
lamin A isoform A | Lmna | T19, S22 | SGAQASST*PLS*PTR | NP_001002011 | -1.15 | -0.53 | ||
lamin A isoform A | Lmna | S22 | SGAQASSTPLS*PTR | NP_001002011 | 0.16 | -0.75 | ||
lamin B1 | Lmnb1 | T21, S24 | ASAPAT*PLS*PTR | NP_034851 | -0.5 | 0.81 | ||
lamin B1 | Lmnb1 | T21 | ASAPAT*PLSPTR | NP_034851 | ||||
lamin B1 | Lmnb1 | S392, S394 | LKLS*PS*PSSR | NP_034851 | 0.51 | 0.29 | ||
lamin B1 | Lmnb1 | S392 | LKLS*PSPSSR | NP_034851 | -0.13 | 0.12 | 0.35 | |
LIM domain only 7 | Lmo7 | S1020 | ATFSSMSGLDSVSDSGEGRGS*PLR | NP_963287 | -0.14 | |||
LIM domain only 7 | Lmo7 | S822 | LAPS*PSEEPR | NP_963287 | 0.51 | -0.02 | ||
LIM domain only 7 | Lmo7 | S824 | LAPSPS*EEPR | NP_963287 | 0.53 | |||
LIM domain only 7 | Lmo7 | S1533 | RGES*LDNLDSQRPGSWR | NP_963287 | -0.13 | |||
LIM domain only 7 | Lmo7 | S1607 | S*HSPSMSQSGSQLR | NP_963287 | -0.29 | -0.64 | ||
LIM domain only 7 | Lmo7 | S1446 | S*TTELNDPLIEK | NP_963287 | -0.34 | |||
LIM domain only 7 | Lmo7 | S1516 | SAS*VNKEPICLPGIMR | NP_963287 | 1.18 | |||
LIM domain only 7 | Lmo7 | S1609 | SHS*PSMSQSGSQLR | NP_963287 | -0.15 | |||
LIM domain only 7 | Lmo7 | S1611 | SHSPS*MSQSGSQLR | NP_963287 | 0.07 | -0.98 | ||
LIM domain only 7 | Lmo7 | S1446 | SRS*TTELNDPLIEK | NP_963287 | -0.73 | |||
lemur tyrosine kinase 2 | Lmtk2 | S781 | RHS*GTSPQASPALLTEEGSPTAPTDPILKPEETK | NP_001074578 | 5.97 | |||
PREDICTED: hypothetical protein | LOC100038833 | T125 | LGELWNNT*AGDDKQPYEK | XP_001471993 | -0.02 | |||
PREDICTED: hypothetical protein | LOC100039048 | T329, S331, S338 | LKPQT*QS*KKSSTTS*PEFPRVNK | XP_001472212 | ||||
PREDICTED: hypothetical protein | LOC100039130 | S22 | SS*QHSESKRR | XP_001472562 | ||||
PREDICTED: hypothetical protein | LOC100039660 | S90, T91 | KQVARVDFS*T*VLPR | XP_001473329 | 6.39 | |||
PREDICTED: hypothetical protein | LOC100039711 | S116 | RCLSCLGLGGS*AGR | XP_001473418 | ||||
PREDICTED: hypothetical protein | LOC100039861 | S275, S280 | S*PLSRS*GGRGGESPARRPPR | XP_001473729 | ||||
PREDICTED: hypothetical protein | LOC100039866 | S55 | RKS*MKEEDEEQEEEGR | XP_001473734 | ||||
PREDICTED: similar to LOC654472 protein | LOC100039875 | Y312 | LISWY*DNESGYSNR | XP_001473700 | -0.21 | |||
PREDICTED: similar to LOC654472 protein | LOC100039875 | S316 | LISWYDNES*GYSNR | XP_001473700 | -0.16 | -0.11 | ||
PREDICTED: hypothetical protein | LOC100040144 | S48, T49, T51 | CVGALLHMVS*T*AT*RHSNLLNMKR | XP_001474208 | ||||
PREDICTED: hypothetical protein | LOC100040353 | S249, S254 | WGLGS*PRIRS*R | XP_001474589 | ||||
PREDICTED: similar to Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) isoform 1 | LOC100042427 | S156 | IVSNASCTTNCLS*PLAK | XP_001478533 | ||||
PREDICTED: hypothetical protein | LOC100042430 | S45, S46, S47, S48 | RCSS*S*S*S*R | XP_001478231 | ||||
PREDICTED: hypothetical protein | LOC100042659 | T591 | KIVVKSPHILPITTT*QKHTIK | XP_001478651 | ||||
PREDICTED: hypothetical protein | LOC100042659 | T365 | TEAKGNQDVT*ISIAKGMK | XP_001478651 | ||||
PREDICTED: similar to olfactory receptor 1506 | LOC100042690 | S4 | MAAS*LALMAKTGGEFLLVLSK | XP_001478690 | ||||
PREDICTED: hypothetical protein | LOC100042779 | Y195 | GGKEGTY*ID | XP_001478846 | ||||
PREDICTED: hypothetical protein | LOC100042787 | T17, S20 | KKDT*VLS*GGQK | XP_001478729 | ||||
PREDICTED: hypothetical protein | LOC100042825 | S249, S257 | QS*LTVTASLS*QINKELK | XP_001478950 | 6.36 | |||
PREDICTED: hypothetical protein | LOC100043364 | S139 | WPHGTS*R | XP_001480095 | ||||
PREDICTED: similar to Desmoglein 2 | LOC100044529 | S59, S63 | VS*TSDS*DAIR | XP_001472346 | ||||
PREDICTED: hypothetical protein | LOC100044534 | S177 | TVVS*EQKAKDTNTAAK | XP_001472223 | ||||
PREDICTED: similar to platelet-derived growth factor B chain | LOC100044675 | T185, T190, S192 | CETIVT*PRPVT*RS*PGTSREQRAK | XP_001473338 | 5.35 | |||
PREDICTED: hypothetical protein isoform 1 | LOC100045119 | S18 | EPRS*PGAAAAR | XP_001473792 | 2.41 | |||
PREDICTED: similar to Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) isoform 1 | LOC100045120 | T256 | YDDT*KKVVKQASEGPLK | XP_001473321 | ||||
PREDICTED: similar to Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) | LOC100045932 | S49 | FS*WYDNEYGYSNR | XP_001475249 | -0.21 | 0.05 | 0.05 | |
PREDICTED: similar to Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) | LOC100045932 | Y51 | FSWY*DNEYGYSNR | XP_001475249 | ||||
PREDICTED: similar to PRAMEl7 | LOC100045957 | S71, S72 | ETSNFGFMLS*S*GKLPR | XP_001475295 | ||||
PREDICTED: hypothetical protein | LOC100046011 | S618, S619 | IAMNS*S*LQVVVER | XP_001475421 | <-10 | |||
PREDICTED: hypothetical protein | LOC100046206 | T3 | MKT*RVNKIMLK | XP_001475070 | ||||
PREDICTED: similar to insulinoma protein (rig) isoform 1 | LOC100046223 | Y97 | DMIILPEMVGSMVGMY*NG | XP_001475799 | ||||
PREDICTED: similar to Igha protein | LOC100046275 | T89 | LT*ISKDTSRNQ | XP_001475969 | ||||
PREDICTED: similar to contactin associated protein-like 5-2 isoform 1 | LOC100046392 | S206 | TS*TKLQKLQGSVKGMLMTR | XP_001476354 | ||||
PREDICTED: similar to heterogeneous nuclear ribonucleoprotein U-like 2 | LOC100046594 | S183 | AVGEQGDDQDS*EKSKPAGSDGER | XP_001477737 | -0.53 | |||
PREDICTED: hypothetical protein | LOC100046750 | Y96, S98, T101, S112 | FRQGMDY*NS*HDT*RVPLLIRGFAS*LPGR | XP_001476795 | ||||
PREDICTED: hypothetical protein | LOC100046869 | T113 | LYTLVTYVPVIT*FK | XP_001476707 | ||||
PREDICTED: hypothetical protein | LOC100048318 | T11, Y13, Y30 | VT*RY*MLSRPFRKHAVVSLATY*MQIYK | XP_001479686 | ||||
PREDICTED: hypothetical protein | LOC100048318 | T11, S16, Y34 | VT*RYMLS*RPFRKHAVVSLATYMQIY*K | XP_001479686 | ||||
PREDICTED: similar to D19Ertd652e protein | LOC100048534 | T154 | T*KTAEAIQK | XP_001480835 | ||||
PREDICTED: similar to D19Ertd652e protein | LOC100048534 | T156 | TKT*AEAIQK | XP_001480835 | 3.48 | |||
PREDICTED: similar to CSRP2BP | LOC100048644 | S53, T65, T68 | S*SKAVLGLSVLLT*AAT*VAGVHLK | XP_001480838 | ||||
PREDICTED: hypothetical protein | LOC100048648 | T37 | ALAST*QHK | XP_001480844 | 11.63 | |||
PREDICTED: similar to Iqcc protein | LOC100048835 | T333 | KAETQLPT*LSENLNIEDR | XP_001477390 | ||||
PREDICTED: hypothetical protein | LOC100048858 | T121, Y122, T128 | GAMVAT*Y*FALNRT*PQAPR | XP_001473040 | 0.89 | |||
PREDICTED: hypothetical protein | LOC242025 | T26 | DLT*HFLKWPCYIRLQR | XP_143236 | ||||
PREDICTED: similar to acidic ribosomal phosphoprotein P1 isoform 1 | LOC279067 | S38 | SAGVS*VEPFWPGLFAK | XP_205095 | ||||
PREDICTED: similar to carbonyl reductase 2 | LOC386400 | S3, S5 | S*CS*RIALVTGANK | XP_359206 | ||||
PREDICTED: similar to STAT3-interacting protein as a repressor | LOC434799 | S240 | YFRWS*ADSR | XP_001476131 | 1.53 | |||
PREDICTED: similar to Ig alpha-chain precursor (V139-D-J1) | LOC544908 | T76, Y78, S81 | SGST*NY*NPS*LKSQVSITR | XP_619045 | ||||
PREDICTED: similar to Chain , Calmodulin | LOC545867 | T121 | HVMT*NLGEKLADEEVDEMIR | XP_001479932 | ||||
PREDICTED: similar to Chain , Calmodulin | LOC545867 | T121, T121 | HVMT*NLGEKLADEEVDEMIR | XP_001479932 | ||||
PREDICTED: similar to Chain , Calmodulin | LOC545867 | T121 | HVMT*NLGEKLADEEVDEMIR | XP_001479932 | ||||
PREDICTED: hypothetical protein | LOC639171 | S237 | VYYS*PPVAR | XP_001479940 | -0.64 | |||
PREDICTED: hypothetical protein | LOC640549 | S26, T35 | KS*QGPKGGGNT*VK | XP_001475772 | ||||
PREDICTED: hypothetical protein | LOC668604 | T8 | MSRRTSTT*R | XP_001002582 | 7.68 | |||
PREDICTED: hypothetical protein | LOC672445 | T52 | AGRRSAGLAT*R | XP_001478791 | 0.42 | |||
PREDICTED: similar to hCG2011852 | LOC674334 | S2887 | GGPKKTNISSS*K | XP_978892 | ||||
PREDICTED: similar to histone H4 | LOC674678 | S8 | MVLGRQQS*TK | XP_981474 | ||||
PREDICTED: similar to chromosome 10 open reading frame 79 | LOC677171 | T326 | EIVEVQATTT*IAKK | XP_001001131 | 4.9 | |||
LON peptidase N-terminal domain and ring finger 1 | Lonrf1 | S701, T705 | S*VVDT*VGGKRFRVLK | NP_001074619 | ||||
latrophilin 2 | Lphn2 | S1458 | GNS*DGYIIPINK | NP_001074767 | 0.09 | |||
lipin 3 | Lpin3 | S408 | RWS*EPSNQK | NP_075021 | 2.48 | |||
LPS-responsive beige-like anchor isoform gamma | Lrba | S999 | AS*SIDSASNTELQTHDMSSDEK | NP_001071155 | 0.55 | |||
LPS-responsive beige-like anchor isoform gamma | Lrba | S1000 | ASS*IDSASNTELQTHDMSSDEK | NP_001071155 | 0.55 | -0.3 | ||
LPS-responsive beige-like anchor isoform gamma | Lrba | T1217, S1221 | ATNLAGET*ESVS*DCADNVSEAPATSEQK | NP_001071155 | -0.42 | |||
LPS-responsive beige-like anchor isoform gamma | Lrba | S979 | GVDVSVGSQHEDRKDS*PISPHFTR | NP_001071155 | -0.86 | |||
LPS-responsive beige-like anchor isoform gamma | Lrba | S979 | KDS*PISPHFTR | NP_001071155 | -0.41 | -0.46 | ||
low density lipoprotein receptor-related protein 2 | Lrp2 | S4624 | EAVAVAPPPS*PSLPAK | NP_001074557 | 0.24 | -0.37 | -0.2 | |
low density lipoprotein receptor-related protein 2 | Lrp2 | S4636 | RSS*TPGYTATEDTFK | NP_001074557 | 3.1 | |||
low density lipoprotein receptor-related protein 2 | Lrp2 | S4636 | RSS*TPGYTATEDTFKDTANLVK | NP_001074557 | 8.35 | |||
low density lipoprotein receptor-related protein 2 | Lrp2 | T4637 | RSST*PGYTATEDTFKDTANLVK | NP_001074557 | 6.95 | |||
low density lipoprotein receptor-related protein 2 | Lrp2 | T4643 | RSSTPGYTAT*EDTFKDTANLVK | NP_001074557 | >10 | |||
leucine rich repeat containing 16A | Lrrc16a | T920 | LEDLDTCMMT*PK | NP_081101 | -0.03 | 0.11 | -0.71 | |
leucine rich repeat containing 16A | Lrrc16a | S972 | RSS*GLISELPSEEGR | NP_081101 | 0.26 | |||
leucine rich repeat containing 16A | Lrrc16a | S1335 | S*WGPAQEYQEQK | NP_081101 | -0.72 | |||
leucine rich repeat containing 16A | Lrrc16a | S972 | SS*GLISELPSEEGR | NP_081101 | 0.03 | |||
leucine rich repeat containing 16A | Lrrc16a | S1289, S1291 | TASRPEDTPDS*PS*GPSSPK | NP_081101 | -2.14 | |||
leucine rich repeat containing 16A | Lrrc16a | S1289, S1294 | TASRPEDTPDS*PSGPS*SPK | NP_081101 | -1.12 | |||
leucine rich repeat containing 16A | Lrrc16a | S1289, S1295 | TASRPEDTPDS*PSGPSS*PK | NP_081101 | -2.36 | |||
leucine rich repeat containing 16A | Lrrc16a | S1289 | TASRPEDTPDS*PSGPSSPK | NP_081101 | -0.65 | |||
leucine rich repeat containing 16A | Lrrc16a | S1291 | TASRPEDTPDSPS*GPSSPK | NP_081101 | -1.62 | -3.2 | ||
leucine rich repeat containing 16A | Lrrc16a | S1294 | TASRPEDTPDSPSGPS*SPK | NP_081101 | -1.77 | -2.31 | ||
leucine rich repeat containing 16A | Lrrc16a | S1295 | TASRPEDTPDSPSGPSS*PK | NP_081101 | -1.57 | -2.14 | -2.31 | * |
leucine rich repeat containing 39 isoform 1 | Lrrc39 | T117, S119 | IPEFIGRFQHLIVLDLSRNT*IS*EIPR | NP_081597 | <-10 | |||
leucine rich repeat (in FLII) interacting protein 1 isoform 1 | Lrrfip1 | S614 | AGS*REPVEDPQSGSSGK | NP_001104781 | -0.9 | |||
leucine rich repeat (in FLII) interacting protein 1 isoform 1 | Lrrfip1 | S501 | DEKPIQAEAQAS*PGAPINQSGHQDTTGPGSTDAQR | NP_001104781 | 0.22 | |||
leucine rich repeat (in FLII) interacting protein 1 isoform 1 | Lrrfip1 | S547 | SEQQAEALDS*PQKK | NP_001104781 | -0.86 | |||
leucine rich repeat (in FLII) interacting protein 2 | Lrrfip2 | S88, S91 | NSASATTPLS*GNS*SR | NP_082018 | -0.73 | |||
leucine rich repeat (in FLII) interacting protein 2 | Lrrfip2 | S88, S92 | NSASATTPLS*GNSS*R | NP_082018 | -0.74 | |||
leucine rich repeat (in FLII) interacting protein 2 | Lrrfip2 | S92 | NSASATTPLSGNSS*R | NP_082018 | 0.13 | |||
leucine rich repeat (in FLII) interacting protein 2 | Lrrfip2 | S96 | RGS*GDTSSLIDPDTSLSELR | NP_082018 | 0.38 | 0.25 | ||
leucine rich repeat (in FLII) interacting protein 2 | Lrrfip2 | S100 | RGSGDTS*SLIDPDTSLSELR | NP_082018 | <-10 | 0.25 | ||
leucine rich repeat (in FLII) interacting protein 2 | Lrrfip2 | S101 | RGSGDTSS*LIDPDTSLSELR | NP_082018 | 0.81 | |||
leucine-rich repeat transmembrane neuronal 3 protein | Lrrtm3 | T337 | ENT*IICASPK | NP_848793 | ||||
LSM12 homolog | Lsm12 | T75 | TET*PPPLASLNVSK | NP_766535 | 0.02 | |||
LSM14 homolog A | Lsm14a | S216 | RS*PVPARPLPPTSQK | NP_080224 | 0.06 | |||
LSM14 homolog A | Lsm14a | S192 | S*PTMEQAVQTASAHLPAPAPVGR | NP_080224 | 0.21 | 0.1 | ||
LSM14 homolog A | Lsm14a | S216 | S*PVPARPLPPTSQK | NP_080224 | -0.06 | 0.19 | ||
LSM14 homolog A | Lsm14a | T194 | SPT*MEQAVQTASAHLPAPAPVGR | NP_080224 | -0.08 | |||
LSM14 homolog A | Lsm14a | S183 | SS*PQLDPLR | NP_080224 | -0.48 | 0.17 | 0.23 | |
LSM14 homolog A | Lsm14a | S183 | SS*PQLDPLRK | NP_080224 | 0.02 | |||
LUC7-like 2 | Luc7l2 | S383, S384 | SEDRRS*S*EEREAGEI | NP_619621 | 0.19 | |||
leucine zipper protein 1 | Luzp1 | S261 | KGS*LDYLK | NP_077772 | 1.02 | |||
Ly1 antibody reactive clone | Lyar | S285 | KRPKHS*GAESGYK | NP_079557 | ||||
Ly6/Plaur domain containing 3 | Lypd3 | T64, S78 | MKTVKCGPGVDVCT*EAVGAVETIHGQFS*VAVR | NP_598504 | ||||
lysosomal trafficking regulator | Lyst | Y2952 | CY*LTIPNKYLLR | NP_034878 | >10 | |||
metastasis associated in colon cancer 1 | Macc1 | S139 | SKS*VSELLDVLGDR | NP_001156608 | 0.56 | |||
metastasis associated in colon cancer 1 | Macc1 | S19 | SRS*EGNLIDMEASKR | NP_001156608 | 0.76 | |||
microtubule-actin crosslinking factor 1 | Macf1 | S1860 | RQGS*FSEDVISHK | NP_033730 | 0.18 | |||
microtubule-actin crosslinking factor 1 | Macf1 | T4757 | RT*GTVQVLK | NP_033730 | ||||
PDZ domain containing, X chromosome | Magix | S237 | SLDPRGS*RVESR | NP_061302 | ||||
mitogen activated protein kinase kinase 2 | Map2k2 | S394 | LKQPS*TPTR | NP_075627 | -0.05 | 0.24 | -0.08 | |
mitogen activated protein kinase kinase 2 | Map2k2 | T395 | LKQPST*PTR | NP_075627 | -0.15 | -0.19 | ||
mitogen-activated protein kinase kinase kinase 1 | Map3k1 | S142 | S*PAGAEPPSAAAPSGR | NP_036075 | -0.25 | |||
mitogen activated protein kinase kinase kinase 2 | Map3k2 | S163 | DRS*SPPPGYIPDELHQIAR | NP_036076 | 0.37 | |||
mitogen activated protein kinase kinase kinase 2 | Map3k2 | S164 | DRSS*PPPGYIPDELHQIAR | NP_036076 | 0.39 | |||
mitogen activated protein kinase kinase kinase 2 | Map3k2 | S153 | RLS*VVGPPNR | NP_036076 | 3.06 | 0.54 | ||
mitogen activated protein kinase kinase kinase 4 | Map3k4 | S232 | LLLKLTSVS*K | NP_036078 | ||||
mitogen-activated protein kinase kinase kinase 7 | Map3k7 | S412 | S*IQDLTVTGTEPGQVSSR | NP_766276 | 0.53 | |||
mitogen-activated protein kinase kinase kinase 9 | Map3k9 | S545 | SSPPAS*PTIIPRLR | NP_796369 | 6.58 | |||
mitogen-activated protein kinase kinase kinase kinase 3 | Map4k3 | S464, S465, S467 | RCPS*S*GS*PAKPSHVPPRPPPPR | NP_001074826 | ||||
mitogen-activated protein kinase kinase kinase kinase 5 | Map4k5 | S433 | RQS*SPSCVPVAETSSSIGNGDGISK | NP_958927 | 1.55 | |||
mitogen-activated protein kinase kinase kinase kinase 5 | Map4k5 | S434 | RQSS*PSCVPVAETSSSIGNGDGISK | NP_958927 | 2.1 | |||
mitogen-activated protein kinase kinase kinase kinase 5 | Map4k5 | S436 | RQSSPS*CVPVAETSSSIGNGDGISK | NP_958927 | 1.55 | |||
mitogen-activated protein kinase kinase kinase kinase 5 | Map4k5 | S335 | TAS*EINFDK | NP_958927 | 0.06 | -0.81 | ||
mitogen-activated protein kinase kinase kinase kinase 5 | Map4k5 | S335 | TAS*EINFDKLQFEPPLRK | NP_958927 | -0.2 | |||
mitogen-activated protein kinase kinase kinase kinase 5 | Map4k5 | T400 | VNT*YPEDSLPDEEK | NP_958927 | 1.71 | 2.22 | 1.82 | * |
mitogen-activated protein kinase 1 | Mapk1 | T183, Y185 | VADPDHDHTGFLT*EY*VATR | NP_001033752 | -2.18 | -1.3 | ||
mitogen-activated protein kinase 1 | Mapk1 | Y185 | VADPDHDHTGFLTEY*VATR | NP_001033752 | -3.66 | -0.64 | ||
mitogen-activated protein kinase 14 | Mapk14 | T180 | HTDDEMT*GYVATR | NP_036081 | 0.17 | |||
mitogen-activated protein kinase 14 | Mapk14 | Y182 | HTDDEMTGY*VATR | NP_036081 | -0.11 | 0.1 | ||
mitogen activated protein kinase 3 | Mapk3 | Y205 | IADPEHDHTGFLTEY*VATR | NP_036082 | -2.87 | |||
mitogen-activated protein kinase associated protein 1 | Mapkap1 | S510 | RTS*FSFQK | NP_796319 | 0.35 | |||
mitogen-activated protein kinase associated protein 1 | Mapkap1 | S512 | RTSFS*FQK | NP_796319 | 0.45 | |||
microtubule-associated protein tau isoform a | Mapt | S191 | SGYSSPGS*PGTPGSR | NP_001033698 | 1.13 | |||
microtubule-associated protein tau isoform a | Mapt | S389 | SPVVS*GDTSPR | NP_001033698 | -0.35 | |||
microtubule-associated protein tau isoform a | Mapt | T392 | SPVVSGDT*SPR | NP_001033698 | 0.08 | |||
microtubule-associated protein tau isoform a | Mapt | S393 | SPVVSGDTS*PR | NP_001033698 | 0.32 | |||
membrane-associated ring finger (C3HC4) 6 | March6 | S894 | LVNYERKS*GK | NP_766194 | ||||
myristoylated alanine rich protein kinase C substrate | Marcks | S140 | AEDGAAPSPS*SETPK | NP_032564 | -2.95 | |||
myristoylated alanine rich protein kinase C substrate | Marcks | S140 | AEDGAAPSPS*SETPKK | NP_032564 | -0.91 | |||
myristoylated alanine rich protein kinase C substrate | Marcks | S140 | AEDGAAPSPS*SETPKKK | NP_032564 | -5.87 | |||
myristoylated alanine rich protein kinase C substrate | Marcks | S141 | AEDGAAPSPSS*ETPK | NP_032564 | -2.67 | |||
myristoylated alanine rich protein kinase C substrate | Marcks | S141 | AEDGAAPSPSS*ETPKK | NP_032564 | -1.08 | |||
myristoylated alanine rich protein kinase C substrate | Marcks | T143 | AEDGAAPSPSSET*PK | NP_032564 | -2.33 | -1.66 | -2.61 | * |
MARCKS-like 1 | Marcksl1 | T170 | EGDT*EEEAGPQAAEPSTPSGPESGPTPASAEQNE | NP_034937 | ||||
MARCKS-like 1 | Marcksl1 | T183 | EGDTEEEAGPQAAEPST*PSGPESGPTPASAEQNE | NP_034937 | ||||
MARCKS-like 1 | Marcksl1 | S185 | EGDTEEEAGPQAAEPSTPS*GPESGPTPASAEQNE | NP_034937 | ||||
MARCKS-like 1 | Marcksl1 | S22 | GDVTAEEAAGAS*PAK | NP_034937 | 0.04 | -0.33 | 0.22 | |
MARCKS-like 1 | Marcksl1 | S104 | LSGLS*FK | NP_034937 | 0.4 | |||
MARCKS-like 1 | Marcksl1 | S104 | LSGLS*FKR | NP_034937 | -0.38 | |||
MAP/microtubule affinity-regulating kinase 2 isoform 2 | Mark2 | S480 | S*RNSPLLDR | NP_001073857 | ||||
MAP/microtubule affinity-regulating kinase 2 isoform 2 | Mark2 | S483 | SRNS*PLLDR | NP_001073857 | -2.55 | -1.12 | ||
MAP/microtubule affinity-regulating kinase 2 isoform 2 | Mark2 | S453 | VPAS*PLPGLDR | NP_001073857 | -0.83 | -1.82 | ||
MAP/microtubule affinity-regulating kinase 2 isoform 2 | Mark2 | S512 | VPVAS*PSAHNISSSSGAPDR | NP_001073857 | -1.07 | |||
MAP/microtubule affinity-regulating kinase 3 isoform 1 | Mark3 | S419 | RYS*DHAGPAIPSVVAYPK | NP_067491 | 1.47 | |||
MAP/microtubule affinity-regulating kinase 4 | Mark4 | T300 | RCT*LEQIMK | NP_758483 | ||||
methionine-tRNA synthetase | Mars | S827 | GS*PKPAAVEAVTAAGSQHIQTLTDEVTK | NP_001003913 | 0.31 | |||
PREDICTED: microtubule associated serine/threonine kinase 3 isoform 2 | Mast3 | S51, S81, S85 | S*GNRKSLVVGTPSPTLSRPLSPLSVPTAGNS*PLDS*PR | XP_893383 | ||||
matrin 3 | Matr3 | S188 | RDS*FDDRGPSLNPVLDYDHGSR | NP_034901 | 2.33 | 0.68 | ||
matrin 3 | Matr3 | S598 | SYS*PDGKESPSDKK | NP_034901 | -0.09 | |||
matrin 3 | Matr3 | S619 | TDAQKTES*PAEGKEQEEK | NP_034901 | -0.14 | |||
O-acyltransferase (membrane bound) domain containing 2 isoform b | Mboat2 | S440 | RTS*TQENVHLSQAK | NP_001076810 | 0.9 | |||
O-acyltransferase (membrane bound) domain containing 2 isoform b | Mboat2 | T441 | RTST*QENVHLSQAK | NP_001076810 | ||||
methylcrotonoyl-Coenzyme A carboxylase 2 (beta) | Mccc2 | S328, S342 | S*FDVREVIARIVDGS*R | NP_084302 | ||||
minichromosome maintenance complex component 10 | Mcm10 | S209, S218, S219 | MRTPAQPLQVS*SSFLEPNHS*S*SSR | NP_081566 | ||||
minichromosome maintenance deficient 2 mitotin | Mcm2 | S41 | ADALTSS*PGR | NP_032590 | 0 | |||
minichromosome maintenance deficient 2 mitotin | Mcm2 | S40 | DALTS*SPGR | NP_032590 | -0.06 | |||
minichromosome maintenance deficient 2 mitotin | Mcm2 | S139, S140 | GLLYDS*S*EEDEERPAR | NP_032590 | -0.09 | |||
minichromosome maintenance deficient 2 mitotin | Mcm2 | S139 | GLLYDS*SEEDEERPAR | NP_032590 | 0.19 | 0.24 | 0 | |
minichromosome maintenance deficient 2 mitotin | Mcm2 | S140 | GLLYDSS*EEDEERPAR | NP_032590 | ||||
minichromosome maintenance deficient 2 mitotin | Mcm2 | S140 | GLLYDSS*EEDEERPARK | NP_032590 | 0.8 | |||
minichromosome maintenance deficient 2 mitotin | Mcm2 | S21, S27 | IS*DPLTSS*PGR | NP_032590 | 1.43 | |||
minichromosome maintenance deficient 2 mitotin | Mcm2 | S27 | ISDPLTSS*PGR | NP_032590 | -1.88 | -0.28 | -0.12 | |
minichromosome maintenance deficient 2 mitotin | Mcm2 | S40 | RADALTS*SPGR | NP_032590 | -0.16 | |||
minichromosome maintenance deficient 2 mitotin | Mcm2 | S41 | RADALTSS*PGR | NP_032590 | -0.1 | |||
minichromosome maintenance deficient 2 mitotin | Mcm2 | S139 | RGLLYDS*SEEDEERPAR | NP_032590 | -0.02 | |||
minichromosome maintenance deficient 2 mitotin | Mcm2 | S140 | RGLLYDSS*EEDEERPAR | NP_032590 | ||||
minichromosome maintenance deficient 2 mitotin | Mcm2 | S21, T25 | RIS*DPLT*SSPGR | NP_032590 | 1.12 | |||
minichromosome maintenance deficient 2 mitotin | Mcm2 | S21, S26 | RIS*DPLTS*SPGR | NP_032590 | 1.52 | 0.78 | ||
minichromosome maintenance deficient 2 mitotin | Mcm2 | S21, S27 | RIS*DPLTSS*PGR | NP_032590 | 2.01 | 0.98 | 0.78 | |
minichromosome maintenance deficient 2 mitotin | Mcm2 | S21 | RIS*DPLTSSPGR | NP_032590 | 3.46 | 3.08 | 1.74 | * |
minichromosome maintenance deficient 2 mitotin | Mcm2 | S27 | RISDPLTSS*PGR | NP_032590 | -0.85 | 0 | ||
minichromosome maintenance deficient 2 mitotin | Mcm2 | S21, T25 | RRIS*DPLT*SSPGR | NP_032590 | 0.78 | |||
minichromosome maintenance deficient 2 mitotin | Mcm2 | S21, S27 | RRIS*DPLTSS*PGR | NP_032590 | 2.28 | |||
minichromosome maintenance deficient 2 mitotin | Mcm2 | S21 | RRIS*DPLTSSPGR | NP_032590 | 2.99 | |||
minichromosome maintenance deficient 3 | Mcm3 | S672 | ASEDES*DLEDEEEKSQEDTEQK | NP_032589 | 0.37 | -0.14 | -0.11 | |
minichromosome maintenance deficient 3 | Mcm3 | S672 | ASEDES*DLEDEEEKSQEDTEQKR | NP_032589 | -0.28 | -0.18 | ||
minichromosome maintenance deficient 3 | Mcm3 | S681 | ASEDESDLEDEEEKS*QEDTEQKR | NP_032589 | ||||
minichromosome maintenance deficient 3 | Mcm3 | T712 | DGESYDPYDFSEAET*QMPQVHTPK | NP_032589 | 0.03 | |||
minichromosome maintenance deficient 3 | Mcm3 | T719 | DGESYDPYDFSEAETQMPQVHT*PK | NP_032589 | 0.13 | 0.01 | ||
minichromosome maintenance deficient 3 | Mcm3 | S672 | KASEDES*DLEDEEEKSQEDTEQK | NP_032589 | -0.21 | |||
minichromosome maintenance deficient 3 | Mcm3 | S672 | KASEDES*DLEDEEEKSQEDTEQKR | NP_032589 | -0.14 | |||
minichromosome maintenance deficient 3 | Mcm3 | S672 | KKASEDES*DLEDEEEKSQEDTEQK | NP_032589 | -0.18 | |||
minichromosome maintenance deficient 3 | Mcm3 | S732 | TDDSQEKTDDS*QETQDSQKVELSEPR | NP_032589 | 0.52 | |||
minichromosome maintenance complex component 4 | Mcm4 | S87 | AIPLDFDVSS*PLTYGTPSSR | NP_032591 | -1.17 | |||
minichromosome maintenance complex component 4 | Mcm4 | T19 | GRVT*PTQSLR | NP_032591 | 0.46 | |||
minichromosome maintenance complex component 4 | Mcm4 | T21 | GRVTPT*QSLR | NP_032591 | ||||
minichromosome maintenance complex component 4 | Mcm4 | S53 | RGEDSSTGELLPMPTS*PGADLQSPPAQNALFSSPPQMH | NP_032591 | -0.16 | |||
minichromosome maintenance complex component 4 | Mcm4 | S87 | SLAIPLDFDVSS*PLTYGTPSSR | NP_032591 | -0.82 | |||
minichromosome maintenance complex component 4 | Mcm4 | T19 | VT*PTQSLR | NP_032591 | -0.16 | 0.15 | 0.21 | |
minichromosome maintenance complex component 6 | Mcm6 | S700 | FNGSS*EDASQETVSKPSLR | NP_032593 | -0.22 | |||
minichromosome maintenance complex component 6 | Mcm6 | S704 | FNGSSEDAS*QETVSKPSLR | NP_032593 | -0.23 | |||
minichromosome maintenance complex component 6 | Mcm6 | S689 | VETPDVNLDQEEEIQMETDEGQGGVNGHADS*PAPVNR | NP_032593 | -0.13 | |||
mediator of DNA damage checkpoint 1 | Mdc1 | S168 | VLLAADS*EEEGDFPSGR | NP_001010833 | 0.48 | |||
malate dehydrogenase 1, NAD (soluble) | Mdh1 | S241 | KLS*SAMSAAK | NP_032644 | -0.21 | -0.31 | ||
midkine | Mdk | T127 | T*KSKTKAKK | NP_001012335 | ||||
methyl CpG binding protein 2 isoform 1 | Mecp2 | S95 | AETSESSGSAPAVPEAS*ASPK | NP_001075448 | 1.43 | |||
methyl CpG binding protein 2 isoform 1 | Mecp2 | S97 | AETSESSGSAPAVPEASAS*PK | NP_001075448 | 1.58 | |||
mediator of RNA polymerase II transcription, subunit 19 | Med19 | S226 | NRHS*PDHPGMGSSQASSSSSLR | NP_080161 | -0.06 | |||
mediator of RNA polymerase II transcription, subunit 8 homolog isoform 1 | Med8 | S260, S262 | S*AS*MHPYQR | NP_064384 | ||||
maternal embryonic leucine zipper kinase | Melk | S521 | GTNVFGS*LER | NP_034920 | -0.13 | |||
maternal embryonic leucine zipper kinase | Melk | S49 | IMDKNALGS*DLPR | NP_034920 | ||||
bin3, bicoid-interacting 3, homolog | Mepce | T188, S192 | ALNAET*PKSS*PLPAK | NP_659162 | 0.11 | |||
bin3, bicoid-interacting 3, homolog | Mepce | S126 | RNS*CNVGGGSGGSFK | NP_659162 | 2.15 | |||
methyltransferase-like 3 | Mettl3 | S48 | S*DSPVPTAPTSSGPKPSTTSVAPELATDPELEK | NP_062695 | -0.33 | |||
methyltransferase-like 3 | Mettl3 | S50 | SDS*PVPTAPTSSGPKPSTTSVAPELATDPELEK | NP_062695 | -0.92 | |||
microfibrillar-associated protein 1B | Mfap1b | S116, S118 | IVEPEVVGES*DS*EVEGDAWR | NP_001075444 | 0.14 | |||
microfibrillar-associated protein 1B | Mfap1b | T267 | SLAALDALNT*DDENDEEEYEAWK | NP_001075444 | 0.28 | |||
melanoma inhibitory activity 3 | Mia3 | S1915 | DSLPSGPREEAKPAS*PSSVQDR | NP_796363 | -0.53 | |||
melanoma inhibitory activity 3 | Mia3 | S1915 | EEAKPAS*PSSVQDR | NP_796363 | -0.29 | 0.1 | ||
melanoma inhibitory activity 3 | Mia3 | S1917 | EEAKPASPS*SVQDR | NP_796363 | -0.29 | -0.2 | ||
melanoma inhibitory activity 3 | Mia3 | S1765 | HSASDPGPAPVVNSS*SR | NP_796363 | 0.16 | -0.18 | ||
melanoma inhibitory activity 3 | Mia3 | S1766 | HSASDPGPAPVVNSSS*R | NP_796363 | 0.46 | -0.12 | ||
PREDICTED: MICAL C-terminal like isoform 1 | Micalcl | T361, S371 | TSPKPESKT*LPRGQPHARS*FSLR | XP_133714 | ||||
misshapen-like kinase 1 isoform 3 | Mink1 | S766 | SDSVLPASHGHLPQAGS*LER | NP_001039424 | -0.37 | |||
antigen identified by monoclonal antibody Ki 67 | Mki67 | T780, T783, T791 | SIKHENT*VQT*PKNVHNIT*DLEK | NP_001074586 | ||||
megakaryoblastic leukemia (translocation) 1 isoform 2 | Mkl1 | T453, S457 | FGSTGST*PPVS*PTPSER | NP_001076005 | -0.25 | -0.3 | -0.11 | |
MKL/myocardin-like 2 isoform 3 | Mkl2 | S77 | EQLVDQGIMPPLKS*PAAFHEQIK | NP_001116139 | -2.37 | |||
MKL/myocardin-like 2 isoform 3 | Mkl2 | S220 | VSAS*PPPVTASTPAQFTSVSPAVPEFLK | NP_001116139 | -0.17 | |||
myeloid leukemia factor 1 interacting protein | Mlf1ip | S238, S248 | QS*DITELDVILS*VFEK | NP_082249 | ||||
myeloid leukemia factor 2 homolog | Mlf2 | S237 | LAIQGPEDS*PSR | NP_663360 | -1.1 | -0.73 | -0.03 | |
PREDICTED: myeloid/lymphoid or mixed-lineage leukemia 2 | Mll2 | S4475 | ALS*PVIPIIPR | XP_619357 | 2.32 | |||
PREDICTED: myeloid/lymphoid or mixed-lineage leukemia 2 | Mll2 | S4096 | VS*PAAAQLADTFFGK | XP_619357 | -0.17 | |||
myeloid/lymphoid or mixed lineage-leukemia translocation to 4 homolog | Mllt4 | S1172, S1182 | ADHRS*SPNVANQPPS*PGGK | NP_034936 | -1.16 | |||
myeloid/lymphoid or mixed lineage-leukemia translocation to 4 homolog | Mllt4 | S1201 | ITSVS*TGNLCTEEQSPPPRPEAYPIPTQTYTR | NP_034936 | -0.52 | |||
myeloid/lymphoid or mixed lineage-leukemia translocation to 4 homolog | Mllt4 | T1207 | ITSVSTGNLCT*EEQSPPPRPEAYPIPTQTYTR | NP_034936 | -0.44 | |||
myeloid/lymphoid or mixed lineage-leukemia translocation to 4 homolog | Mllt4 | S1211 | ITSVSTGNLCTEEQS*PPPRPEAYPIPTQTYTR | NP_034936 | -0.54 | |||
myeloid/lymphoid or mixed lineage-leukemia translocation to 4 homolog | Mllt4 | S1172, S1182 | S*SPNVANQPPS*PGGK | NP_034936 | -1.05 | -0.24 | -0.22 | |
myeloid/lymphoid or mixed lineage-leukemia translocation to 4 homolog | Mllt4 | S1173, S1182 | SS*PNVANQPPS*PGGK | NP_034936 | -0.54 | -0.22 | ||
myeloid/lymphoid or mixed lineage-leukemia translocation to 4 homolog | Mllt4 | S1173, S1182 | SS*PNVANQPPS*PGGKGPYTSGTAAK | NP_034936 | -0.24 | |||
myeloid/lymphoid or mixed lineage-leukemia translocation to 4 homolog | Mllt4 | S1173 | SS*PNVANQPPSPGGK | NP_034936 | 0.26 | |||
myeloid/lymphoid or mixed lineage-leukemia translocation to 4 homolog | Mllt4 | S1182 | SSPNVANQPPS*PGGK | NP_034936 | 0.17 | 0.14 | 0.64 | |
myeloid/lymphoid or mixed lineage-leukemia translocation to 4 homolog | Mllt4 | T1081 | T*SSVVTLEVAK | NP_034936 | 0.06 | |||
myeloid/lymphoid or mixed lineage-leukemia translocation to 4 homolog | Mllt4 | S216 | TIS*NPEVVMK | NP_034936 | -0.21 | -0.07 | -0.25 | |
myeloid/lymphoid or mixed lineage-leukemia translocation to 4 homolog | Mllt4 | S1719 | TQVLS*PDSLFTAK | NP_034936 | -1.3 | |||
myeloid/lymphoid or mixed lineage-leukemia translocation to 4 homolog | Mllt4 | S1083 | TSS*VVTLEVAK | NP_034936 | -0.15 | -3.64 | ||
myeloid/lymphoid or mixed lineage-leukemia translocation to 4 homolog | Mllt4 | S1275 | VTRS*QEELREEK | NP_034936 | 0.02 | |||
myeloid/lymphoid or mixed lineage-leukemia translocation to 6 homolog | Mllt6 | S411 | ARAPS*PGDYK | NP_647472 | ||||
myeloid/lymphoid or mixed lineage-leukemia translocation to 6 homolog | Mllt6 | S318, S319 | KSS*S*HSLSHK | NP_647472 | ||||
myelin-associated oligodendrocytic basic protein isoform b | Mobp | T157, S162 | GPGT*SRGGS*PTRAPR | NP_001034454 | ||||
monoacylglycerol O-acyltransferase 2 | Mogat2 | Y154, S162 | DY*IMSGGLVS*SEK | NP_803231 | ||||
MON2 homolog isoform 1 | Mon2 | S534 | RDEQAAS*DPMDQETVSR | NP_001156496 | -0.55 | |||
microrchidia 2A isoform 1 | Morc2a | S854 | LMKPPS*PEHQSPDTQQEGGEEEEAMVAR | NP_001152760 | 0.83 | |||
microrchidia 2A isoform 1 | Morc2a | T862 | LMKPPSPEHQSPDT*QQEGGEEEEAMVAR | NP_001152760 | 0.87 | |||
microrchidia 2A isoform 1 | Morc2a | T338 | QVQNT*AITLR | NP_001152760 | ||||
microrchidia 3 | Morc3 | S563 | RLS*NPPVENSSYK | NP_001038994 | 5.22 | |||
membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 5) | Mpp5 | S83 | KQELDLNS*SMR | NP_062525 | -0.68 | |||
membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 5) | Mpp5 | S84 | KQELDLNSS*MR | NP_062525 | 1.13 | -0.54 | ||
myosin phosphatase Rho interacting protein isoform 2 | Mprip | T218, S225 | AKDQPDGT*SLSPAQS*PSQSQPPAACTPR | NP_036157 | -1.14 | |||
myosin phosphatase Rho interacting protein isoform 2 | Mprip | S219, S225 | AKDQPDGTS*LSPAQS*PSQSQPPAACTPR | NP_036157 | -1.24 | |||
myosin phosphatase Rho interacting protein isoform 2 | Mprip | S990 | S*KSNPDFLKK | NP_036157 | ||||
myosin phosphatase Rho interacting protein isoform 2 | Mprip | S992 | SKS*NPDFLKK | NP_036157 | 0.03 | |||
mitochondrial ribosomal protein L20 | Mrpl20 | T66 | NLRT*LWINR | NP_079846 | 1.17 | |||
membrane-spanning 4-domains, subfamily A, member 7 isoform b | Ms4a7 | T27 | T*GHTYEK | NP_001020781 | ||||
mutS homolog 6 | Msh6 | S63 | SAAVSASS*PEAK | NP_034960 | 0.43 | |||
mutS homolog 6 | Msh6 | T883, S892, S894 | T*LKQVVTLQS*KS*PKGR | NP_034960 | ||||
mutS homolog 6 | Msh6 | S137 | VHVQFFDDS*PTR | NP_034960 | 0.08 | 0.6 | ||
mutS homolog 6 | Msh6 | T139 | VHVQFFDDSPT*R | NP_034960 | 0.6 | |||
mutS homolog 6 | Msh6 | S869 | VMCKVS*GLLEEVAGGFTSK | NP_034960 | 2.27 | |||
metallothionein 1 | Mt1 | S6, S8 | S*CS*TGGSCTCTSSCACK | NP_038630 | 0.26 | |||
metallothionein 1 | Mt1 | S42 | SCCSCCPVGCS*K | NP_038630 | ||||
metallothionein 2 | Mt2 | S45 | CS*QGCICK | NP_032656 | ||||
metastasis associated 3 | Mta3 | S516 | HAELSGS*PLK | NP_473423 | 0.63 | 0.17 | ||
metastasis associated 3 | Mta3 | S425 | MPTQSDEEKS*PSPTAEDPR | NP_473423 | 0.03 | |||
metastasis associated 3 | Mta3 | S427 | MPTQSDEEKSPS*PTAEDPR | NP_473423 | -0.14 | 0.94 | ||
metastasis associated 3 | Mta3 | T429 | MPTQSDEEKSPSPT*AEDPR | NP_473423 | 0.09 | |||
microtubule-associated protein 1B | Mtap1b | S1497 | LGGDVS*PTQIDVSQFGSFK | NP_032660 | 2.49 | |||
microtubule-associated protein 1B | Mtap1b | T2246 | TKKPGT*KTK | NP_032660 | 9999 | |||
microtubule-associated protein 1S | Mtap1s | T659 | ST*SPHDVDLCLVSPCEFSHR | NP_766601 | -0.28 | |||
microtubule-associated protein 1S | Mtap1s | S660 | STS*PHDVDLCLVSPCEFSHR | NP_766601 | -0.18 | |||
microtubule-associated protein 2 isoform 1 | Mtap2 | T235, T248 | SGTST*PTTPGSTAITPGT*PPSYSSR | NP_001035023 | 0.51 | |||
microtubule-associated protein 2 isoform 1 | Mtap2 | T237, T248 | SGTSTPT*TPGSTAITPGT*PPSYSSR | NP_001035023 | 2.85 | |||
microtubule-associated protein 2 isoform 1 | Mtap2 | S241, T248 | SGTSTPTTPGS*TAITPGT*PPSYSSR | NP_001035023 | 0.25 | |||
microtubule-associated protein 2 isoform 1 | Mtap2 | T259, T262 | TPGT*PGT*PSYPR | NP_001035023 | -1.59 | |||
microtubule-associated protein 2 isoform 1 | Mtap2 | S453 | VDHGAEIITQS*PSR | NP_001035023 | -0.91 | |||
microtubule-associated protein 4 | Mtap4 | S760 | RTS*PSKPSSAPALKPGPK | NP_032659 | -0.16 | |||
microtubule-associated protein 7 | Mtap7 | S316 | RTLS*PSNLK | NP_032661 | -0.83 | |||
mitochondrial carrier homolog 1 | Mtch1 | S381 | RVS*SGSCFALE | NP_063933 | 0.2 | 0.9 | ||
mitochondrial carrier homolog 1 | Mtch1 | S384 | RVSSGS*CFALE | NP_063933 | 0.54 | |||
LYRIC | Mtdh | S545, S551, S555, T557 | S*NAKQNS*VPPS*QT*K | NP_080278 | ||||
LYRIC | Mtdh | S565 | SETNWES*PK | NP_080278 | -0.44 | |||
LYRIC | Mtdh | S417 | SQEPIS*NDQKVSDDDKEKGEGALPTGK | NP_080278 | 0.71 | |||
LYRIC | Mtdh | S423 | SQEPISNDQKVS*DDDKEK | NP_080278 | 0.09 | |||
LYRIC | Mtdh | S423 | SQEPISNDQKVS*DDDKEKGEGALPTGK | NP_080278 | -0.25 | |||
metal response element binding transcription factor 2 | Mtf2 | S25, S27 | NQKTS*AS*LNK | NP_038855 | ||||
PREDICTED: myotubularin related protein 15 isoform 1 | Mtmr15 | S416 | AIITRFYQLSAS*GQK | XP_890895 | ||||
myotubularin-related protein 2 | Mtmr2 | S630 | AS*SPAQCVTPVQTVV | NP_076347 | ||||
myotubularin-related protein 2 | Mtmr2 | S631 | ASS*PAQCVTPVQTVV | NP_076347 | ||||
myotubularin-related protein 2 | Mtmr2 | S5 | SS*SCESLGAQLPAAR | NP_076347 | -0.16 | |||
myotubularin-related protein 2 | Mtmr2 | S6 | SSS*CESLGAQLPAAR | NP_076347 | 0.09 | |||
myotrophin | Mtpn | T31 | GEDVNRT*LEGGR | NP_032124 | -0.36 | |||
PREDICTED: similar to mucin 16 | Muc16 | S666, T667 | NGSS*T*PK | XP_001476141 | ||||
skeletal muscle receptor tyrosine kinase isoform 1 precursor | Musk | Y188, T198 | EDAGQY*RCVAKNSLGT*AYSK | NP_001032204 | 6.43 | |||
melanocyte proliferating gene 1 | Myg1 | S280 | EHLYHLES*ELSPK | NP_068359 | 0.58 | |||
melanocyte proliferating gene 1 | Myg1 | S283 | EHLYHLESELS*PK | NP_068359 | 0.09 | |||
myosin heavy chain 10, non-muscle | Myh10 | S1956 | QLHIEGASLELS*DDDTESK | NP_780469 | 0.74 | |||
myosin heavy chain 10, non-muscle | Myh10 | S1975 | TSDVNDTQPPQS*E | NP_780469 | ||||
myosin, heavy polypeptide 14 | Myh14 | S1965 | LEEGVAS*DEEEAEGAEPGSAPGQEPEAPPPATPQ | NP_082297 | ||||
myosin, heavy polypeptide 9, non-muscle isoform 1 | Myh9 | T1939 | GT*GDCSDEEVDGKADGADAK | NP_071855 | -0.08 | |||
myosin, heavy polypeptide 9, non-muscle isoform 1 | Myh9 | S1943 | GTGDCS*DEEVDGK | NP_071855 | 0.05 | |||
myosin, heavy polypeptide 9, non-muscle isoform 1 | Myh9 | S1943 | GTGDCS*DEEVDGKADGADAK | NP_071855 | 0.45 | -0.04 | -1.17 | |
myosin, heavy polypeptide 9, non-muscle isoform 1 | Myh9 | T1939, S1943 | KGT*GDCS*DEEVDGKADGADAK | NP_071855 | 0.32 | |||
myosin, heavy polypeptide 9, non-muscle isoform 1 | Myh9 | T1939 | KGT*GDCSDEEVDGK | NP_071855 | -0.01 | |||
myosin, heavy polypeptide 9, non-muscle isoform 1 | Myh9 | T1939 | KGT*GDCSDEEVDGKADGADAK | NP_071855 | -0.17 | |||
myosin, heavy polypeptide 9, non-muscle isoform 1 | Myh9 | S1943 | KGTGDCS*DEEVDGK | NP_071855 | -0.01 | |||
myosin, heavy polypeptide 9, non-muscle isoform 1 | Myh9 | S1943 | KGTGDCS*DEEVDGKADGADAK | NP_071855 | 1.26 | -0.29 | ||
myosin, light chain 12B, regulatory | Myl12b | T19 | AT*SNVFAMFDQSQIQEFK | NP_075891 | 0.59 | -0.34 | ||
myosin, light chain 12B, regulatory | Myl12b | S20 | ATS*NVFAMFDQSQIQEFK | NP_075891 | 0.29 | -0.02 | -0.33 | |
myosin, light polypeptide kinase | Mylk | S386 | QSS*LGGSVGNK | NP_647461 | ||||
myosin, light polypeptide kinase | Mylk | S364 | VPAIGSFS*PGEDR | NP_647461 | -4.02 | |||
myosin, light polypeptide kinase | Mylk | S364 | VPAIGSFS*PGEDRK | NP_647461 | ||||
myosin XVIIIA | Myo18a | S2022, S2024 | FSHSYLS*DS*DTEAK | NP_035716 | 0.03 | |||
myosin XVIIIA | Myo18a | S2022 | FSHSYLS*DSDTEAK | NP_035716 | 2.05 | |||
myosin XVIIIA | Myo18a | S140 | RFS*FSQR | NP_035716 | 0.23 | 0.09 | ||
myosin XVIIIA | Myo18a | S145 | S*RDESASETSTPSEHSAAPSPQVEVR | NP_035716 | 0.64 | |||
myosin XVIIIA | Myo18a | S157 | SRDESASETSTPS*EHSAAPSPQVEVR | NP_035716 | -1.31 | |||
myosin IG | Myo1g | T323, T336, S339 | LTAT*PRDLVLRTLLART*VAS*GGR | NP_848534 | -16.87 | |||
PREDICTED: myosin 1H | Myo1h | S6 | MNAVVS*LDTTKEEVR | XP_977982 | 7.14 | |||
myosin IXb isoform 1 | Myo9b | S1275 | AQDKPES*PSGSTQIQR | NP_001135794 | -0.17 | |||
myomesin family, member 3 | Myom3 | T1298 | YTLEIT*AGK | NP_001078978 | ||||
phosphonoformate immuno-associated protein 5 | N4bp2l2 | T408 | GLPGSGKT*TLSRILLGQSR | NP_958757 | ||||
Ngfi-A binding protein 2 isoform 2 | Nab2 | S6 | APS*PTAEQPPGR | NP_001116367 | 0.15 | -0.13 | ||
Ngfi-A binding protein 2 isoform 1 | Nab2 | T434 | LT*PPPADLPLALPAHGLWSR | NP_032694 | 0.1 | -0.16 | ||
nascent polypeptide-associated complex alpha subunit isoform a | Naca | S574, S577, S582 | ADS*CVS*PNTVS*QPLKR | NP_001106670 | 3.57 | |||
nascent polypeptide-associated complex alpha subunit isoform a | Naca | S2138 | VQGEAVSNIQENTQTPTVQEES*EEEEVDETGVEVK | NP_001106670 | -0.19 | |||
neuronal apoptosis inhibitory protein 5 | Naip5 | S993 | ALPDISEGYWKLS*PKPCKIPK | NP_035000 | ||||
voltage gated channel like 1 | Nalcn | T1699 | TTMKT*VVCK | NP_796367 | ||||
nucleosome assembly protein 1-like 4 | Nap1l4 | S125 | EFITGDVEPTDAESAWHS*ENEEEDK | NP_032698 | -0.01 | |||
nucleosome assembly protein 1-like 4 | Nap1l4 | S125 | EFITGDVEPTDAESAWHS*ENEEEDKLAGDMK | NP_032698 | -0.04 | |||
nicotinate phosphoribosyltransferase domain containing 1 | Naprt1 | T416 | QT*LPGSKAAFR | NP_766195 | ||||
NMDA receptor-regulated gene 1 | Narg1 | S854 | ITVNGDS*SAETEELANEI | NP_444319 | ||||
NMDA receptor-regulated gene 1 | Narg1 | S855 | ITVNGDSS*AETEELANEI | NP_444319 | ||||
nuclear autoantigenic sperm protein isoform 2 | Nasp | S466 | EGEETEGS*EEEDRENDKAEETPNESVLEK | NP_058057 | -0.18 | |||
N-acetyltransferase 12 | Nat12 | Y297, T304 | Y*RRNGIGT*NLVK | NP_001074899 | >10 | |||
neuron navigator 1 | Nav1 | S491, S493 | KLEYDS*GS*LKMEPGTSK | NP_775613 | ||||
neuron navigator 3 | Nav3 | S334, S336, S342 | S*KS*MNVKHS*ATSTMLTVKQPSPATSPTPSSDR | NP_001074504 | 4.18 | |||
neurobeachin like 1 | Nbeal1 | Y1776, T1778 | WKAIRLY*LT*CER | NP_775620 | ||||
nibrin | Nbn | S398 | KLS*QETFNIK | NP_038780 | 1.77 | |||
neurocan | Ncan | S67, S68 | RLS*S*LR | NP_031815 | 1.61 | |||
non-catalytic region of tyrosine kinase adaptor protein 1 | Nck1 | S85 | RKPS*VPDTASPADDSFVDPGER | NP_035008 | 1.48 | |||
nucleolin | Ncl | S403 | NLS*FNITEDELK | NP_035010 | -0.45 | |||
nuclear receptor coactivator 3 | Ncoa3 | S846 | AVS*LDSPVSVGSGPPVK | NP_032705 | -1.54 | |||
nuclear receptor coactivator 5 | Ncoa5 | S377, S381 | LLRS*SADS*LPGPISR | NP_659141 | -0.21 | |||
nuclear receptor coactivator 5 | Ncoa5 | S378 | SS*ADSLPGPISR | NP_659141 | -0.81 | |||
nuclear receptor coactivator 6 | Ncoa6 | S2015, T2019 | EIVEKS*KTLT*SR | NP_062799 | 2.22 | |||
nuclear receptor co-repressor 1 | Ncor1 | S225 | QQQLEEEAAKPPEPEKPVS*PPPVEQK | NP_035438 | 0.29 | 0.15 | ||
nuclear receptor co-repressor 2 | Ncor2 | T1385 | EGT*PPPPPPPR | NP_035554 | -0.24 | 0.12 | 0.21 | |
nuclear receptor co-repressor 2 | Ncor2 | S215 | QQQLEEEAAKPPEPEKPVS*PPPIESK | NP_035554 | 0.69 | |||
nuclear distribution gene E homolog 1 isoform a | Nde1 | S307, T308, S309, S315 | RPGS*T*S*VGDKGS*GKR | NP_075806 | ||||
N-myc downstream regulated 1 | Ndrg1 | S326, T328 | S*RT*ASGSSVTSLEGTR | NP_032707 | 0.27 | |||
N-myc downstream regulated 1 | Ndrg1 | S326, S330 | S*RTAS*GSSVTSLEGTR | NP_032707 | 0.27 | |||
N-myc downstream regulated 1 | Ndrg1 | S326, S332 | S*RTASGS*SVTSLEGTR | NP_032707 | 0.37 | |||
N-myc downstream regulated 1 | Ndrg1 | S326, S333 | S*RTASGSS*VTSLEGTR | NP_032707 | -0.35 | |||
N-myc downstream regulated 1 | Ndrg1 | T328, S330 | SRT*AS*GSSVTSLEGTR | NP_032707 | 0.36 | |||
N-myc downstream regulated 1 | Ndrg1 | S330, S336 | SRTAS*GSSVTS*LEGTRSR | NP_032707 | ||||
N-myc downstream regulated 1 | Ndrg1 | S332, S333 | SRTASGS*S*VTSLEGTR | NP_032707 | 1.99 | |||
N-myc downstream regulated 1 | Ndrg1 | T328 | T*ASGSSVTSLEGTR | NP_032707 | -0.72 | -0.02 | -0.14 | |
N-myc downstream regulated 1 | Ndrg1 | S330, S333 | TAS*GSS*VTSLEGTR | NP_032707 | -1.19 | |||
N-myc downstream regulated 1 | Ndrg1 | S330 | TAS*GSSVTSLEGTR | NP_032707 | -0.72 | -0.53 | ||
N-myc downstream regulated 1 | Ndrg1 | S332 | TASGS*SVTSLEGTR | NP_032707 | -0.47 | |||
N-myc downstream regulated 1 | Ndrg1 | S333, S336 | TASGSS*VTS*LEGTR | NP_032707 | -1.46 | |||
N-myc downstream regulated 1 | Ndrg1 | S333 | TASGSS*VTSLEGTR | NP_032707 | ||||
N-myc downstream regulated 1 | Ndrg1 | T335 | TASGSSVT*SLEGTR | NP_032707 | -0.46 | |||
NADH-ubiquinone oxidoreductase flavoprotein 3 isoform 1 | Ndufv3 | S165 | VTNDSSSSSSSSSSDSDS*DGEEHDSDRAPR | NP_084363 | -0.49 | |||
nebulin | Neb | Y2352, T2353, S2354 | TKY*T*S*PVDMLGVVLAK | NP_035019 | ||||
neural precursor cell expressed, developmentally down-regulated gene 4 | Nedd4 | T287 | RPSPDDDLT*DEDNDDMQLQAQR | NP_035020 | 0.06 | |||
neural precursor cell expressed, developmentally down-regulated gene 4 | Nedd4 | S309 | RQIS*EDVDGPDNR | NP_035020 | 1.03 | |||
neural precursor cell expressed, developmentally down-regulated gene 4-like isoform 1 | Nedd4l | S447 | S*LSSPTVTLSAPLEGAK | NP_001107858 | 0.66 | 0.42 | 0.17 | |
neural precursor cell expressed, developmentally down-regulated gene 4-like isoform 1 | Nedd4l | S449 | SLS*SPTVTLSAPLEGAK | NP_001107858 | 0.85 | |||
neural precursor cell expressed, developmentally down-regulated gene 4-like isoform 1 | Nedd4l | S450 | SLSS*PTVTLSAPLEGAK | NP_001107858 | ||||
neurofilament, heavy polypeptide | Nefh | S529, S541 | SPGEAKS*PGEAKSPAEAKS*PGEAK | NP_035034 | ||||
neurofilament, heavy polypeptide | Nefh | T988 | TETT*KTEAEDTKAK | NP_035034 | ||||
NIMA-related kinase 1 | Nek1 | S997 | TCS*LPDLSK | NP_780298 | 0.27 | |||
NIMA-related kinase 11 | Nek11 | T263 | YPRELNT*IMERMLNK | NP_766049 | 9.18 | |||
neuroepithelial cell transforming gene 1 isoform 2 | Net1 | T116 | ESLTT*REIKR | NP_001040624 | ||||
sialidase 4 | Neu4 | T21 | ERTGLT*YR | NP_776133 | 9.67 | |||
F | Nf1 | S1403, S1409 | ENKKSVVSQRFPQNS*IGAVGS*AMFLR | NP_035027 | ||||
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 isoform b | Nfatc2 | T327 | T*SPDPTPVSTAPSK | NP_001032254 | 0.43 | 0.21 | 0.08 | |
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 isoform b | Nfatc2 | T218, S223 | T*SPIMS*PR | NP_001032254 | 0.48 | |||
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 isoform b | Nfatc2 | S328 | TS*PDPTPVSTAPSK | NP_001032254 | 0.66 | 0.35 | 0.1 | |
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 isoform b | Nfatc2 | S219, S223 | TS*PIMS*PR | NP_001032254 | 0.43 | 0.44 | ||
nuclear factor kappa-B, subunit 1 | Nfkb1 | S63, S71, S72 | YVCEGPS*HGGLPGAS*S*EK | NP_032715 | ||||
nuclear factor of kappa light polypeptide gene enhancer in B-cells 2, p49/p100 | Nfkb2 | T425 | DTDAGEGAEEPRT*PPEAPQGEPQALDTLQR | NP_062281 | -0.76 | |||
NF-kappa-B inhibitor-like protein 2 | Nfkbil2 | T783, S785 | IPDPPKSRETAT*SS*ACR | NP_898914 | ||||
delangin isoform A | Nipbl | S2652 | AITSLLGGGS*PK | NP_081983 | -1.17 | |||
delangin isoform A | Nipbl | S306 | GSRPPLILQSQSLPCSS*PR | NP_081983 | 0.06 | |||
NFKB activating protein | Nkap | S5, S15 | APVS*GSRSPEREAS*GAK | NP_080213 | ||||
NFKB activating protein-like | Nkapl | S141 | IGELGAPEVWGLS*PK | NP_079995 | -0.14 | 0.11 | ||
NLR family, pyrin domain containing 4A | Nlrp4a | S864, S868, T875 | NNQNLVS*LQVS*NNKLEDT*GVK | NP_766484 | <-10 | |||
nicotinamide mononucleotide adenylyltransferase 2 | Nmnat2 | S161 | ILGKVGESLS*R | NP_780669 | ||||
N-myristoyltransferase 1 | Nmt1 | S47 | SGLS*PANDTGAK | NP_032733 | 0.5 | 0.23 | ||
nucleolar and coiled-body phosphoprotein 1 isoform B | Nolc1 | S561 | AAKES*EEEEEEEETEEK | NP_001034440 | 0.29 | -0.09 | ||
nucleolar and coiled-body phosphoprotein 1 isoform B | Nolc1 | S561 | AAKES*EEEEEEEETEEKK | NP_001034440 | -0.02 | |||
nucleolar and coiled-body phosphoprotein 1 isoform B | Nolc1 | S561 | AAKES*EEEEEEEETEEKKK | NP_001034440 | -0.22 | |||
probable nucleolar complex protein 14 | Nop14 | S198 | TRKELIEELIAKS*K | NP_083554 | ||||
nucleolar protein 1 | Nop2 | S783, S794 | RKS*MTKGNSQPLLS* | NP_620086 | ||||
nucleolar protein 5A | Nop56 | T436 | EAVVQAEEAAAEIT*RK | NP_077155 | <-10 | |||
nucleolar protein 5A | Nop56 | S513 | EELAS*DLEEMATSSAK | NP_077155 | 0.09 | 0.35 | ||
nucleolar protein 5A | Nop56 | S536, S543 | EEVAS*EPEEAAS*PTTPK | NP_077155 | -0.13 | |||
nucleolar protein 5A | Nop56 | S536, T545 | EEVAS*EPEEAASPT*TPK | NP_077155 | -0.14 | |||
nucleolar protein 5A | Nop56 | S536, T546 | EEVAS*EPEEAASPTT*PK | NP_077155 | -0.17 | |||
nucleolar protein 5A | Nop56 | S536 | EEVAS*EPEEAASPTTPK | NP_077155 | 0.24 | 0.25 | 0.31 | * |
nucleolar protein 5A | Nop56 | S554 | KFS*EEPEVAANFTK | NP_077155 | 4.32 | |||
nucleolar protein 5A | Nop56 | S528, T545 | S*SPKEEVASEPEEAASPT*TPK | NP_077155 | ||||
nucleolar protein 5A | Nop56 | S529, S543 | SS*PKEEVASEPEEAAS*PTTPK | NP_077155 | 0.63 | |||
nucleolar protein 5A | Nop56 | S536, S543 | SSPKEEVAS*EPEEAAS*PTTPK | NP_077155 | 0.03 | |||
nucleolar protein 5A | Nop56 | S536, T545 | SSPKEEVAS*EPEEAASPT*TPK | NP_077155 | 0.25 | |||
nucleolar protein 5A | Nop56 | S536 | SSPKEEVAS*EPEEAASPTTPK | NP_077155 | -0.13 | |||
nucleolar protein 5 | Nop58 | S509, S521 | EEPLS*EEEPCTSTAVPS*PEK | NP_061356 | 0.28 | |||
nucleolar protein 5 | Nop58 | S509 | EEPLS*EEEPCTSTAVPSPEK | NP_061356 | 0.06 | |||
nucleolar protein 5 | Nop58 | S509, S521 | HIKEEPLS*EEEPCTSTAVPS*PEK | NP_061356 | 0.21 | |||
nucleolar protein 5 | Nop58 | S509 | HIKEEPLS*EEEPCTSTAVPSPEK | NP_061356 | 0.2 | -0.09 | ||
nucleolar protein 5 | Nop58 | S509 | HIKEEPLS*EEEPCTSTAVPSPEKK | NP_061356 | -0.22 | |||
nephrosis 1 homolog, nephrin | Nphs1 | S515 | RVQLGS*VEK | NP_062332 | -0.67 | |||
nucleophosmin 1 | Npm1 | S125 | AES*EDEDEEDVK | NP_032748 | -1.35 | |||
nucleophosmin 1 | Npm1 | S106, S125 | CGS*GPVHISGQHLVAVEEDAES*EDEDEEDVK | NP_032748 | ||||
nucleophosmin 1 | Npm1 | S112, S125 | CGSGPVHIS*GQHLVAVEEDAES*EDEDEEDVK | NP_032748 | ||||
nucleophosmin 1 | Npm1 | S125 | CGSGPVHISGQHLVAVEEDAES*EDEDEEDVK | NP_032748 | ||||
nucleophosmin 1 | Npm1 | S125 | CGSGPVHISGQHLVAVEEDAES*EDEDEEDVK | NP_032748 | 0.47 | |||
nucleophosmin 1 | Npm1 | S70 | DELHIVEAEAMNYEGS*PIK | NP_032748 | 0.61 | |||
nucleophosmin 1 | Npm1 | S216 | DLKPS*TPR | NP_032748 | ||||
nucleophosmin 1 | Npm1 | T217 | DLKPST*PR | NP_032748 | -0.8 | |||
natriuretic peptide receptor 1 | Npr1 | S659 | S*SNCVVDGR | NP_032753 | 31.96 | |||
nuclear receptor subfamily 3, group C, member 2 | Nr3c2 | S248, S250, S262, S263 | GSRS*HS*PVHASNVGSPLS*S*PLSSMK | NP_001077375 | ||||
nuclear receptor binding protein | Nrbp1 | T433 | TPT*PEPAEVETR | NP_671734 | 0.17 | -0.03 | -0.02 | |
nardilysin | Nrd1 | S85 | LGADES*EEEGR | NP_666262 | 0.32 | |||
nucleosome binding protein 1 | Nsbp1 | T29 | LSAMPVPFT*PELKPK | NP_057919 | ||||
p47 protein | Nsfl1c | S116 | KKS*PNELVDDLFK | NP_938085 | 0.49 | -0.27 | ||
p47 protein | Nsfl1c | S178 | RHS*GQDVHVVLK | NP_938085 | 1.11 | 1.65 | ||
p47 protein | Nsfl1c | S116 | S*PNELVDDLFK | NP_938085 | -0.6 | |||
p47 protein | Nsfl1c | S142 | VTKS*PGETSKPRPFAGGGYR | NP_938085 | -0.41 | |||
NSL1, MIND kinetochore complex component | Nsl1 | S136, T140, S147 | RILES*VIKT*LKAQHAS*LK | NP_941056 | ||||
non-SMC element 2, MMS21 homolog | Nsmce2 | S200 | MIES*KHKRKK | NP_081022 | ||||
NOL1/NOP2/Sun domain family, member 2 | Nsun2 | S657 | EGVILTNENAAS*PEQPGDEDAK | NP_663329 | -0.04 | |||
5'-nucleotidase, cytosolic II | Nt5c2 | T510 | NRT*SVDFK | NP_084086 | 1.86 | |||
5'-nucleotidase, cytosolic II | Nt5c2 | S511 | NRTS*VDFK | NP_084086 | 0.22 | |||
nucleobindin 1 | Nucb1 | S452 | KVPEQPPELPQLDS*QHL | NP_032775 | 0.77 | |||
nucleobindin 1 | Nucb1 | S85 | SGKLS*QELDFVSHNVR | NP_032775 | ||||
nuclear casein kinase and cyclin-dependent kinase substrate 1 isoform 2 | Nucks1 | T178, S180 | ATVT*PS*PVK | NP_001139276 | -0.23 | |||
nuclear casein kinase and cyclin-dependent kinase substrate 1 isoform 2 | Nucks1 | S180 | ATVTPS*PVK | NP_001139276 | 0.45 | |||
nuclear casein kinase and cyclin-dependent kinase substrate 1 isoform 2 | Nucks1 | S213 | EEDEEAES*PPEKK | NP_001139276 | 0.33 | -0.02 | ||
nuclear casein kinase and cyclin-dependent kinase substrate 1 isoform 2 | Nucks1 | S19 | KVVDYSQFQES*DDADEDYGR | NP_001139276 | 0.92 | -0.84 | ||
nuclear casein kinase and cyclin-dependent kinase substrate 1 isoform 2 | Nucks1 | S19 | KVVDYSQFQES*DDADEDYGRDSGPPAK | NP_001139276 | -0.15 | |||
nuclear casein kinase and cyclin-dependent kinase substrate 1 isoform 2 | Nucks1 | T178, S180 | LKATVT*PS*PVKGK | NP_001139276 | 0.01 | |||
nuclear casein kinase and cyclin-dependent kinase substrate 1 isoform 2 | Nucks1 | S180 | LKATVTPS*PVKGK | NP_001139276 | 0.5 | |||
nuclear casein kinase and cyclin-dependent kinase substrate 1 isoform 2 | Nucks1 | S58, S61 | NSQEDS*EDS*EEKDVK | NP_001139276 | -0.21 | |||
nuclear casein kinase and cyclin-dependent kinase substrate 1 isoform 2 | Nucks1 | S58 | NSQEDS*EDSEEKDVK | NP_001139276 | 0.13 | 0.92 | ||
nuclear casein kinase and cyclin-dependent kinase substrate 1 isoform 2 | Nucks1 | S61 | NSQEDSEDS*EEKDVK | NP_001139276 | -0.1 | |||
nuclear casein kinase and cyclin-dependent kinase substrate 1 isoform 2 | Nucks1 | S203 | TPS*PKEEDEEAESPPEKK | NP_001139276 | 0.31 | |||
nuclear casein kinase and cyclin-dependent kinase substrate 1 isoform 2 | Nucks1 | S213 | TPSPKEEDEEAES*PPEKK | NP_001139276 | 0.84 | |||
nuclear casein kinase and cyclin-dependent kinase substrate 1 isoform 2 | Nucks1 | S19 | VVDYSQFQES*DDADEDYGR | NP_001139276 | 0.21 | 0.29 | -0.05 | |
nuclear casein kinase and cyclin-dependent kinase substrate 1 isoform 2 | Nucks1 | S19 | VVDYSQFQES*DDADEDYGRDSGPPAK | NP_001139276 | -0.24 | |||
nuclear casein kinase and cyclin-dependent kinase substrate 1 isoform 2 | Nucks1 | S19 | VVDYSQFQES*DDADEDYGRDSGPPAKK | NP_001139276 | -0.4 | |||
nuclear distribution gene C homolog | Nudc | S139 | NGSLDS*PGKQDAEDEEDEEDEKDKGK | NP_035078 | -0.18 | |||
nudix-type motif 5 | Nudt5 | S10 | ESTESS*PGKHLVTSEELISEGK | NP_058614 | 0.29 | |||
82-kD FMRP Interacting Protein | Nufip2 | T630 | DYEIENQNPLASPTNT*LLGSAK | NP_001019376 | -0.96 | |||
82-kD FMRP Interacting Protein | Nufip2 | S213, S215 | GADNDGS*GS*ESGYTTPK | NP_001019376 | -0.95 | |||
82-kD FMRP Interacting Protein | Nufip2 | S213, Y219 | GADNDGS*GSESGY*TTPK | NP_001019376 | -0.97 | |||
82-kD FMRP Interacting Protein | Nufip2 | S213 | GADNDGS*GSESGYTTPK | NP_001019376 | -1.24 | -0.7 | ||
82-kD FMRP Interacting Protein | Nufip2 | S649 | NDS*WGSFDLR | NP_001019376 | -0.61 | |||
nuclear mitotic apparatus protein 1 | Numa1 | S1739 | TQPDGTSVPGEPAS*PISQR | NP_598708 | -0.26 | 0.08 | -0.17 | |
nuclear mitotic apparatus protein 1 | Numa1 | S1973 | VS*SETHQGPGTPESK | NP_598708 | 0.17 | 0.03 | ||
nuclear mitotic apparatus protein 1 | Numa1 | S1974 | VSS*ETHQGPGTPESK | NP_598708 | 0.23 | |||
nuclear mitotic apparatus protein 1 | Numa1 | T1982 | VSSETHQGPGT*PESK | NP_598708 | -0.68 | |||
nucleoporin 155 | Nup155 | S994 | AAPQSPS*VPK | NP_573490 | 0.06 | |||
nucleoporin 98 | Nup98 | S623 | NLNNSNLFSPVNHDSEDLAS*PSEYPENGER | NP_075355 | 0 | |||
nucleoporin 98 | Nup98 | S888 | SKYGLQDS*DEEEEEHPPK | NP_075355 | 0.82 | |||
nucleoporin 98 | Nup98 | S888 | YGLQDS*DEEEEEHPPK | NP_075355 | 0.11 | 0.03 | ||
nuclear VCP-like | Nvl | S190 | ESLPLDLS*DDQSNSK | NP_080447 | -0.16 | |||
phosphatidylinositol polyphosphate 5-phosphatase | Ocrl | T404 | MTFSVPNQT*VPQVNIMK | NP_796189 | ||||
odd Oz/ten-m homolog 3 isoform 2 | Odz3 | T2432, S2435 | FDLT*EPS*YELVK | NP_001139409 | 9.25 | |||
opioid growth factor receptor-like 1 | Ogfrl1 | S324, T329, T331, S335, S337, S342 | S*KAQKT*PT*LPAS*GS*NGQTS*THKK | NP_001074548 | ||||
opioid growth factor receptor-like 1 | Ogfrl1 | S324, T329, T331, S335, T341, T343 | S*KAQKT*PT*LPAS*GSNGQT*ST*HKK | NP_001074548 | ||||
olfactory receptor 1014 | Olfr1014 | S126, Y131, S132 | YVAIS*KPLLY*S*QAMSLK | NP_666780 | ||||
olfactory receptor 131 | Olfr131 | S232 | AVIKIQS*SEGR | NP_667078 | 2.23 | |||
olfactory receptor 1475 | Olfr1475 | S309 | KVVGKLMTS*LQLVN | NP_666413 | -9999 | |||
olfactory receptor 275 | Olfr275 | S230, S235 | ISS*MDGRS*K | NP_667069 | -5.37 | |||
olfactory receptor 847 | Olfr847 | S223 | IVS*SILKISSLRGR | NP_666736 | ||||
optic atrophy 1 homolog | Opa1 | S318, T323 | IFPRGS*GEMMT*RSPVK | NP_598513 | ||||
origin recognition complex subunit 6-like | Orc6l | S19 | LGLAEPS*VLR | NP_062690 | -0.02 | |||
oxysterol binding protein | Osbp | S349 | GDMS*DEDDENEFFDAPEIITMPENLGHK | NP_001028346 | 0.15 | |||
oxysterol binding protein | Osbp | S377 | TGS*NISGASSDVSLDEQYK | NP_001028346 | 1.07 | |||
oxysterol binding protein | Osbp | S377 | TGS*NISGASSDVSLDEQYKHQLEETKK | NP_001028346 | 0.53 | |||
oxysterol binding protein-like 11 | Osbpl11 | S200 | RPS*QNAMSFFNVGHSK | NP_789810 | 0.89 | |||
oxysterol-binding protein-like protein 3 isoform 2 | Osbpl3 | S369 | ALVHQLS*NESR | NP_001157117 | -1.23 | -0.52 | ||
oxysterol-binding protein-like protein 3 isoform 2 | Osbpl3 | S271 | LHS*SNPNLSTLDFGEEK | NP_001157117 | -0.17 | |||
oxysterol-binding protein-like protein 3 isoform 2 | Osbpl3 | S272 | LHSS*NPNLSTLDFGEEK | NP_001157117 | 0.41 | -0.19 | ||
oxysterol-binding protein-like protein 7 | Osbpl7 | S222 | LHGS*VPNLSR | NP_001074903 | -0.08 | |||
osteoclast stimulating factor 1 | Ostf1 | S203, S214 | TLS*NAEDYLDDEDS*D | NP_059071 | ||||
osteoclast stimulating factor 1 | Ostf1 | S214 | TLSNAEDYLDDEDS*D | NP_059071 | ||||
osteopetrosis associated transmembrane protein 1 | Ostm1 | T328 | SST*SFANIQENAT | NP_766004 | ||||
osteopetrosis associated transmembrane protein 1 | Ostm1 | S329 | SSTS*FANIQENAT | NP_766004 | ||||
PREDICTED: hypothetical protein | OTTMUSG00000007209 | S2 | S*DEAVDTSSEITTK | XP_893385 | ||||
predicted gene, OTTMUSG00000013203 | OTTMUSG00000013203 | S65 | AMGIMNS*FVNDIFER | NP_001091448 | ||||
otubain 1 | Otub1 | S118, S121 | AVS*AKS*K | NP_598911 | ||||
oxidation resistance 1 isoform B | Oxr1 | T115 | VVSST*SEEEEAFTEK | NP_001123635 | -0.78 | |||
oxidation resistance 1 isoform B | Oxr1 | S116 | VVSSTS*EEEEAFTEK | NP_001123635 | -1.28 | -0.68 | -0.05 | |
oxidation resistance 1 isoform D | Oxr1 | S59 | EPAPGDPGCGPEELRPPS*PASPEGPDTGQK | NP_001123637 | 1.01 | -0.36 | -0.32 | |
oxidation resistance 1 isoform D | Oxr1 | S62 | EPAPGDPGCGPEELRPPSPAS*PEGPDTGQK | NP_001123637 | ||||
Snap-25-interacting protein | P140 | S45 | RFS*NVGLVHTSER | NP_061361 | 0.97 | |||
Snap-25-interacting protein | P140 | S1021 | RGS*DELTVPR | NP_061361 | 0.61 | 1.4 | 0.42 | |
Snap-25-interacting protein | P140 | S1035 | TEKPS*KSPPPPPPR | NP_061361 | -0.32 | |||
Snap-25-interacting protein | P140 | S1037 | TEKPSKS*PPPPPPR | NP_061361 | 0.04 | |||
procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), alpha 1 polypeptide | P4ha1 | T67, S68, T69 | LT*S*T*ATK | NP_035160 | 5.99 | |||
phosphofurin acidic cluster sorting protein 2 | Pacs2 | S830, S832, S839 | EVES*KS*QCIEGIS*R | NP_001074639 | ||||
protein kinase C and casein kinase substrate in neurons 2 | Pacsin2 | S399 | TQTYPTDWS*DDESNNPFSSTDANGDSNPFDEDTTSGTEVR | NP_001152981 | 0.16 | |||
protein kinase C and casein kinase substrate in neurons 3 | Pacsin3 | S354 | DGTAPPPQSPSSPGSGQDEDWS*DEESPRK | NP_083009 | 0.37 | 0.24 | ||
platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit | Pafah1b1 | T56 | WT*SVIRLQK | NP_038653 | ||||
platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit | Pafah1b1 | S57 | WTS*VIRLQK | NP_038653 | ||||
phenylalanine hydroxylase | Pah | S97 | RSKPVLGSIIKS*LR | NP_032803 | ||||
p21-activated kinase 2 | Pak2 | S197 | S*VIDPIPAPVGDSNVDSGAK | NP_796300 | -0.83 | |||
p21-activated kinase 2 | Pak2 | Y139 | Y*LSFTPPEK | NP_796300 | 0.1 | |||
p21-activated kinase 2 | Pak2 | S141 | YLS*FTPPEK | NP_796300 | 0.23 | -0.21 | -0.78 | |
p21-activated kinase 2 | Pak2 | S141 | YLS*FTPPEKDGFPSGTPALNTK | NP_796300 | -0.59 | |||
p21-activated kinase 2 | Pak2 | T143 | YLSFT*PPEKDGFPSGTPALNTK | NP_796300 | -0.59 | |||
p21-activated kinase 4 | Pak4 | S99, S104 | SNS*LRRES*PPPPAR | NP_081746 | -0.56 | |||
PABP-dependent poly(A) nuclease 3 | Pan3 | T153 | ITPHT*SPAPR | NP_082567 | -6.71 | |||
pantothenate kinase 3 | Pank3 | S342 | LLAYALDYWS*K | NP_666074 | ||||
poly(A) polymerase gamma | Papolg | S602, S603 | AVS*S*PAVCTIPTVVGR | NP_766143 | -0.06 | |||
poly(A) polymerase gamma | Papolg | S507, S509, S512 | KKS*LS*DVS*RSSGGLQSK | NP_766143 | ||||
partitioning-defective protein 3 homolog isoform 2 | Pard3 | S8 | RS*SDPALTGLSTSVSDNNFSSEEPSR | NP_001013598 | -0.21 | |||
partitioning-defective protein 3 homolog isoform 2 | Pard3 | S9 | RSS*DPALTGLSTSVSDNNFSSEEPSR | NP_001013598 | -0.04 | |||
par-6 (partitioning defective 6) homolog beta | Pard6b | S10 | HGAS*SGCLGTMEVK | NP_067384 | 0.64 | |||
parvin, alpha | Parva | S8, S14 | S*PLVPKS*PTPKSPPSR | NP_065631 | 0 | |||
paired box gene 8 | Pax8 | S304 | NLSTHQTYPVVADPHS*PFAIK | NP_035170 | -1 | |||
polybromo 1 | Pbrm1 | S1468 | AAQQQQPSAS*PR | NP_001074720 | 0.07 | |||
polybromo 1 | Pbrm1 | T9 | AT*SPSSSVSGDFDDGHHSVPTPGPSR | NP_001074720 | -0.26 | |||
polybromo 1 | Pbrm1 | S10 | ATS*PSSSVSGDFDDGHHSVPTPGPSR | NP_001074720 | -0.08 | |||
polybromo 1 | Pbrm1 | T301, S314 | T*ASNLAAARLTGPS*HNK | NP_001074720 | ||||
poly(rC) binding protein 1 | Pcbp1 | S173 | LVMLETLSQS*PQGR | NP_035995 | -0.37 | |||
poly(rC) binding protein 1 | Pcbp1 | S264 | MHGGTGFAGIDSSS*PEVK | NP_035995 | -0.1 | |||
poly(rC) binding protein 1 | Pcbp1 | S190 | VMTIPYQPMPASS*PVICAGGQDR | NP_035995 | -0.29 | -0.79 | ||
poly(rC) binding protein 2 isoform 1 | Pcbp2 | S183 | GVTIPYRPKPS*SSPVIFAGGQDR | NP_001096635 | -1.19 | -1.1 | ||
poly(rC) binding protein 2 isoform 1 | Pcbp2 | S184 | GVTIPYRPKPSS*SPVIFAGGQDR | NP_001096635 | -0.34 | |||
poly(rC) binding protein 2 isoform 1 | Pcbp2 | S185 | GVTIPYRPKPSSS*PVIFAGGQDR | NP_001096635 | -0.93 | -1.01 | ||
poly(rC) binding protein 2 isoform 1 | Pcbp2 | S268 | LHQLAMQQSHFPMTHGNTGFSGIESSS*PEVK | NP_001096635 | 0.28 | |||
poly(rC) binding protein 2 isoform 1 | Pcbp2 | S183 | PS*SSPVIFAGGQDR | NP_001096635 | ||||
poly(rC) binding protein 2 isoform 1 | Pcbp2 | S185 | PSSS*PVIFAGGQDR | NP_001096635 | -0.94 | |||
propionyl Coenzyme A carboxylase, beta polypeptide | Pccb | T425 | HGAKLLYAFAEAT*VPK | NP_080111 | ||||
protocadherin 10 isoform 3 | Pcdh10 | Y1029, T1035 | APY*KPPYLT*RKRIC | NP_001091641 | ||||
protocadherin beta 8 | Pcdhb8 | S773 | FMNPIIPS*SLLQDS | NP_444363 | ||||
pre-mRNA cleavage complex II protein Pcf11 | Pcf11 | S512 | QRSMS*PNLAPKAGKMR | NP_083354 | ||||
polycomb group ring finger 5 | Pcgf5 | Y24, T29, T30, T37 | GY*LIKPT*T*VTECLHT*FCK | NP_083784 | ||||
pericentriolar material 1 | Pcm1 | S1729 | ILEGDHGS*PAGEIDDEDKDKDETETVK | NP_076151 | -0.56 | -0.72 | ||
pericentriolar material 1 | Pcm1 | S957 | SNRPVS*ADGNYRPLAK | NP_076151 | -0.44 | |||
pericentriolar material 1 | Pcm1 | S65, S68 | VTNAIS*PES*SPGVGR | NP_076151 | -0.63 | |||
pericentriolar material 1 | Pcm1 | S65 | VTNAIS*PESSPGVGR | NP_076151 | -1.68 | |||
PEST proteolytic signal containing nuclear protein | Pcnp | S87 | KASAIS*IR | NP_001019793 | ||||
PEST proteolytic signal containing nuclear protein | Pcnp | T139 | NIGRDT*PTSAGPNSFNK | NP_001019793 | -0.99 | |||
pericentrin | Pcnt | S1437 | RNS*EIDELK | NP_032813 | 2.86 | |||
pecanex-like 2 isoform 2 | Pcnxl2 | S516 | VLS*VDSGTDVFLSR | NP_780770 | <-10 | |||
PCTAIRE-motif protein kinase 1 | Pctk1 | S119 | RLS*LPADIR | NP_035179 | -0.24 | |||
PCTAIRE-motif protein kinase 1 | Pctk1 | S153 | RVS*LSEIGFGK | NP_035179 | 0.09 | |||
PCTAIRE protein kinase 2 | Pctk2 | S180 | RAS*LSEIGFGK | NP_666351 | 0.56 | 0.66 | ||
PCTAIRE protein kinase 2 | Pctk2 | S137 | RIS*MEDLNK | NP_666351 | 0.27 | 0.56 | ||
PCTAIRE protein kinase 2 | Pctk2 | S9 | RLS*LTLR | NP_666351 | ||||
PCTAIRE protein kinase 3 | Pctk3 | S109 | RAS*LSDIGFGK | NP_032821 | 0.81 | 0.47 | 0.22 | |
PCTAIRE protein kinase 3 | Pctk3 | S111 | RASLS*DIGFGK | NP_032821 | -5.53 | |||
PCTAIRE protein kinase 3 | Pctk3 | S66 | RFS*MEDLNK | NP_032821 | 0.69 | 1.15 | 0.68 | * |
PCTAIRE protein kinase 3 | Pctk3 | S66 | RFS*MEDLNKR | NP_032821 | 0.38 | |||
PCTAIRE protein kinase 3 | Pctk3 | S75 | RLS*LPMDIR | NP_032821 | 1.18 | 0.83 | 0.18 | |
choline phosphate cytidylyltransferase 1 alpha | Pcyt1a | S362 | AVTCDIS*EDEED | NP_001156631 | ||||
choline phosphate cytidylyltransferase 1 alpha | Pcyt1a | S315 | MLQAIS*PK | NP_001156631 | -0.03 | -0.36 | -0.24 | |
choline phosphate cytidylyltransferase 1 alpha | Pcyt1a | S331 | SPS*PSFR | NP_001156631 | 0.15 | 0.07 | ||
choline phosphate cytidylyltransferase 1 alpha | Pcyt1a | T342, S346 | T*SPSS*SPASLSR | NP_001156631 | -0.01 | |||
choline phosphate cytidylyltransferase 1 alpha | Pcyt1a | T342, S347 | T*SPSSS*PASLSR | NP_001156631 | -0.3 | -0.18 | -0.01 | |
choline phosphate cytidylyltransferase 1 alpha | Pcyt1a | T342 | T*SPSSSPASLSR | NP_001156631 | 0.36 | 0.6 | ||
choline phosphate cytidylyltransferase 1 alpha | Pcyt1a | S343, S346 | TS*PSS*SPASLSR | NP_001156631 | 0.19 | |||
choline phosphate cytidylyltransferase 1 alpha | Pcyt1a | S343, S347 | TS*PSSS*PASLSR | NP_001156631 | -0.3 | -0.18 | -0.01 | |
choline phosphate cytidylyltransferase 1 alpha | Pcyt1a | S343 | TS*PSSSPASLSR | NP_001156631 | 0.55 | |||
choline phosphate cytidylyltransferase 1 beta isoform 2 | Pcyt1b | S285 | MLQALS*PK | NP_808214 | 0.05 | -0.12 | -0.42 | |
PDGFA associated protein 1 | Pdap1 | S57, S60 | S*LDS*DESEDEDDDYQQK | NP_001028485 | -0.22 | |||
PDGFA associated protein 1 | Pdap1 | S57, S63 | S*LDSDES*EDEDDDYQQK | NP_001028485 | 0.14 | |||
PDGFA associated protein 1 | Pdap1 | S60, S63 | SLDS*DES*EDEDDDYQQK | NP_001028485 | -0.22 | |||
programmed cell death 4 | Pdcd4 | S76 | DSGRGDS*VSDNGSEAVR | NP_035180 | -0.15 | |||
programmed cell death 4 | Pdcd4 | S457 | FVS*EGDGGR | NP_035180 | 0.11 | |||
programmed cell death 4 | Pdcd4 | S457 | RFVS*EGDGGR | NP_035180 | 0.19 | |||
programmed cell death 4 | Pdcd4 | S94 | SGVAVPTS*PK | NP_035180 | -0.21 | -0.1 | ||
programmed cell death 5 | Pdcd5 | S119 | KVMDS*DEDDADY | NP_062720 | 0.28 | 0.03 | -0.13 | |
programmed cell death 5 | Pdcd5 | S119 | VMDS*DEDDADY | NP_062720 | ||||
phosducin-like | Pdcl | T290, S296 | NSAT*CHSEDS*DLEID | NP_080452 | ||||
phosphodiesterase 3B | Pde3b | T599, T604 | EPLNIVET*QEEET*MKKACR | NP_035185 | ||||
phosphodiesterase 4D | Pde4d | S129 | RES*FLYR | NP_035186 | 1.11 | |||
phosphodiesterase 4D interacting protein isoform 1 | Pde4dip | S1249, S1250 | EQLLLRS*S*EGNSK | NP_001034465 | -3.45 | |||
pyruvate dehydrogenase E1 alpha 1 | Pdha1 | Y289, S300 | Y*HGHSMSDPGVS*YR | NP_032836 | -0.25 | |||
pyruvate dehydrogenase E1 alpha 1 | Pdha1 | S232 | YGMGTS*VER | NP_032836 | -0.66 | -0.16 | ||
pyruvate dehydrogenase E1 alpha 1 | Pdha1 | S293, S300 | YHGHS*MSDPGVS*YR | NP_032836 | -0.3 | |||
pyruvate dehydrogenase E1 alpha 1 | Pdha1 | S293 | YHGHS*MSDPGVSYR | NP_032836 | 0.59 | -0.25 | ||
pyruvate dehydrogenase E1 alpha 1 | Pdha1 | S295 | YHGHSMS*DPGVSYR | NP_032836 | 1.19 | -0.86 | ||
PDZ and LIM domain 2 | Pdlim2 | S199, S204 | VLLHS*PGRPS*SPR | NP_666090 | -0.32 | -0.44 | -0.65 | * |
PDZ and LIM domain 2 | Pdlim2 | S199, S205 | VLLHS*PGRPSS*PR | NP_666090 | -0.36 | -0.42 | -0.5 | * |
PDZ and LIM domain 2 | Pdlim2 | S204 | VLLHSPGRPS*SPR | NP_666090 | -0.09 | -0.03 | ||
PDZ and LIM domain 2 | Pdlim2 | S205 | VLLHSPGRPSS*PR | NP_666090 | -0.06 | |||
PDZ and LIM domain 5 isoform ENH1 | Pdlim5 | S332 | KANSTQEPSQQPASSGASPLSASEGPES*PGSSRPSVAGLR | NP_062782 | -2.62 | |||
PDZ and LIM domain 5 isoform ENH1 | Pdlim5 | S228 | RGS*QGDIKQQNGPPR | NP_062782 | 1.78 | |||
PDZ and LIM domain 5 isoform ENH1 | Pdlim5 | S359 | SAAAFKPVGSTSVKS*PSWQRPNQAAPSTGR | NP_062782 | -3.13 | |||
PDZ and LIM domain 7 isoform b | Pdlim7 | T96 | ALT*PPADPPR | NP_001107559 | 0.03 | 0.11 | ||
PDS5, regulator of cohesion maintenance, homolog B | Pds5b | S1356, T1368 | AES*PETSAVESTQST*PQK | NP_780519 | -0.24 | |||
PDS5, regulator of cohesion maintenance, homolog B | Pds5b | S1356 | AES*PETSAVESTQSTPQK | NP_780519 | 0.71 | |||
PDS5, regulator of cohesion maintenance, homolog B | Pds5b | T1359 | AESPET*SAVESTQSTPQK | NP_780519 | 0.12 | |||
PDS5, regulator of cohesion maintenance, homolog B | Pds5b | S1360 | AESPETS*AVESTQSTPQK | NP_780519 | 0.19 | |||
PDS5, regulator of cohesion maintenance, homolog B | Pds5b | S1166 | METVSNASSSSNPSS*PGR | NP_780519 | 0.58 | |||
pyridoxal-dependent decarboxylase domain containing 1 isoform 3 | Pdxdc1 | T684, T691 | VQGT*GVTPPPT*PLGTR | NP_001034622 | ||||
pyridoxal-dependent decarboxylase domain containing 1 isoform 3 | Pdxdc1 | T687, T691 | VQGTGVT*PPPT*PLGTR | NP_001034622 | -1.01 | -1.42 | -2.28 | |
pyridoxal-dependent decarboxylase domain containing 1 isoform 3 | Pdxdc1 | T687 | VQGTGVT*PPPTPLGTR | NP_001034622 | -0.09 | -0.2 | -0.45 | |
pyridoxal-dependent decarboxylase domain containing 1 isoform 3 | Pdxdc1 | T691 | VQGTGVTPPPT*PLGTR | NP_001034622 | -0.35 | |||
pyridoxal-dependent decarboxylase domain containing 1 isoform 1 | Pdxdc1 | S736 | VEQLS*SGLEHDNLEAHSPEQPPR | NP_444411 | 0.56 | |||
PDZ domain containing 8 | Pdzd8 | S286 | KHTLPS*YKIR | NP_001028394 | ||||
phosphoprotein enriched in astrocytes 15 isoform 2 | Pea15a | S116 | DIIRQPS*EEEIIK | NP_035193 | -0.11 | |||
phosphoprotein enriched in astrocytes 15 isoform 2 | Pea15a | S116 | KYKDIIRQPS*EEEIIK | NP_035193 | -0.16 | |||
phosphoprotein enriched in astrocytes 15 isoform 2 | Pea15a | S116 | YKDIIRQPS*EEEIIK | NP_035193 | -0.08 | |||
phosphatidylethanolamine binding protein 1 | Pebp1 | S51 | VLTPTQVMNRPS*SISWDGLDPGK | NP_061346 | -0.09 | |||
period homolog 3 | Per3 | Y542, S547 | Y*LTSYS*LPALKR | NP_035197 | ||||
6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 isoform 3 | Pfkfb2 | S447 | RNS*FTPLSSSNTIR | NP_001155888 | 0.84 | |||
6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 isoform 3 | Pfkfb2 | T449 | RNSFT*PLSSSNTIR | NP_001155888 | 0.38 | |||
phosphofructokinase, liver, B-type | Pfkl | T773 | RT*LSIDKGF | NP_032852 | ||||
phosphofructokinase, liver, B-type | Pfkl | S775 | RTLS*IDKGF | NP_032852 | 0.61 | 0 | 0.56 | |
phosphofructokinase, liver, B-type | Pfkl | T773 | T*LSIDKGF | NP_032852 | ||||
phosphofructokinase, liver, B-type | Pfkl | S775 | TLS*IDKGF | NP_032852 | 0.28 | 0.04 | 0.66 | |
bisphosphoglycerate mutase 1 | Pgam1 | S14 | HGES*AWNLENR | NP_075907 | -0.54 | |||
bisphosphoglycerate mutase 1 | Pgam1 | S118 | RS*YDVPPPPMEPDHPFYSNISK | NP_075907 | 0.09 | |||
bisphosphoglycerate mutase 1 | Pgam1 | Y119 | RSY*DVPPPPMEPDHPFYSNISK | NP_075907 | 0.16 | |||
bisphosphoglycerate mutase 1 | Pgam1 | S118 | S*YDVPPPPMEPDHPFYSNISK | NP_075907 | -0.19 | |||
bisphosphoglycerate mutase 1 | Pgam1 | Y119 | SY*DVPPPPMEPDHPFYSNISK | NP_075907 | 0.03 | |||
bisphosphoglycerate mutase 2 | Pgam2 | Y92 | HY*GGLTGLNK | NP_061358 | 1.02 | |||
phosphoglycerate kinase 1 | Pgk1 | S203 | ALES*PERPFLAILGGAK | NP_032854 | 0.11 | -0.11 | ||
phosphoglycerate kinase 1 | Pgk1 | S320, S321 | TGQATVASGIPAGWMGLDCGTES*S*K | NP_032854 | 6.85 | |||
phosphoglucomutase 2 | Pgm2 | T115 | AIGGIILT*ASHNPGGPNGDFGIK | NP_082408 | 0.31 | -0.21 | ||
phosphoglucomutase 2 | Pgm2 | S117 | AIGGIILTAS*HNPGGPNGDFGIK | NP_082408 | 0.26 | -0.21 | ||
progesterone receptor membrane component | Pgrmc1 | T178 | EGEEPT*VYSDDEEPKDETAR | NP_058063 | ||||
progesterone receptor membrane component | Pgrmc1 | Y180 | EGEEPTVY*SDDEEPKDETAR | NP_058063 | 0.64 | |||
progesterone receptor membrane component | Pgrmc1 | S181 | EGEEPTVYS*DDEEPKDETAR | NP_058063 | 1.12 | -0.04 | 0.06 | |
progesterone receptor membrane component | Pgrmc1 | S181 | EGEEPTVYS*DDEEPKDETARK | NP_058063 | 0.32 | |||
progesterone receptor membrane component | Pgrmc1 | S181 | LLKEGEEPTVYS*DDEEPKDETAR | NP_058063 | -0.08 | |||
progesterone receptor membrane component | Pgrmc1 | T190 | LLKEGEEPTVYSDDEEPKDET*AR | NP_058063 | -0.65 | |||
progesterone receptor membrane component 2 | Pgrmc2 | Y204 | LLKPGEEPSEY*TDEEDTKDHSK | NP_081834 | 0.12 | |||
progesterone receptor membrane component 2 | Pgrmc2 | Y204 | LLKPGEEPSEY*TDEEDTKDHSKQD | NP_081834 | 0.18 | |||
progesterone receptor membrane component 2 | Pgrmc2 | T205 | LLKPGEEPSEYT*DEEDTK | NP_081834 | 1.08 | 0.04 | ||
progesterone receptor membrane component 2 | Pgrmc2 | T205 | LLKPGEEPSEYT*DEEDTKDHSK | NP_081834 | 0.94 | 0.12 | ||
progesterone receptor membrane component 2 | Pgrmc2 | T205 | LLKPGEEPSEYT*DEEDTKDHSKQD | NP_081834 | 0.27 | |||
phosphatase and actin regulator 1 isoform 2 | Phactr1 | S529 | RLS*QRPTAEELEQR | NP_001005740 | -0.65 | |||
phosphatase and actin regulator 4 isoform 2 | Phactr4 | S148 | QPLLPPKRPLSS*SCEAK | NP_001155269 | ||||
phosphatase and actin regulator 4 isoform 2 | Phactr4 | S90 | SS*SPVLVEEEPER | NP_001155269 | 0.27 | |||
phosphatase and actin regulator 4 isoform 2 | Phactr4 | S91 | SSS*PVLVEEEPER | NP_001155269 | 0.27 | -0.05 | -0.4 | |
polyhomeotic-like 3 | Phc3 | T607, T612 | MDRT*PPPPT*LSPAAVTVGR | NP_700470 | -0.2 | |||
polyhomeotic-like 3 | Phc3 | T607, S614 | MDRT*PPPPTLS*PAAVTVGR | NP_700470 | -0.1 | -0.15 | -0.07 | * |
pleckstrin homology domain interacting protein | Phip | Y1042 | Y*HDMPDVIDFLVLR | NP_001074685 | ||||
pleckstrin homology-like domain, family B, member 1 | Phldb1 | S565 | KLS*SGDLR | NP_705765 | 0.65 | |||
pleckstrin homology-like domain, family B, member 2 | Phldb2 | S411 | KSS*ISSISGR | NP_700461 | 0.45 | |||
pleckstrin homology-like domain, family B, member 2 | Phldb2 | S156 | NKS*HDSVYFLGGLEGR | NP_700461 | 0.08 | |||
pleckstrin homology-like domain, family B, member 2 | Phldb2 | S159 | NKSHDS*VYFLGGLEGR | NP_700461 | -0.45 | |||
pleckstrin homology-like domain, family B, member 2 | Phldb2 | S199, S203 | SGAAS*MPSS*PK | NP_700461 | -0.65 | |||
PHD and ring finger domains 1 | Phrf1 | S1201 | EVS*PAPATQGESR | NP_001074587 | -0.46 | -2.12 | ||
phytanoyl-CoA hydroxylase interacting protein-like isoform 2 | Phyhipl | T59 | NSNKFKHKDVPT*K | NP_001156318 | ||||
phosphatidylinositol 4-kinase type 2 alpha | Pi4k2a | S47, S51 | VAAAAGSGPS*PPCS*PGHDR | NP_663476 | -1.61 | |||
phosphatidylinositol 4-kinase type 2 alpha | Pi4k2a | S47 | VAAAAGSGPS*PPCSPGHDR | NP_663476 | -3.72 | |||
phosphatidylinositol 4-kinase type 2 beta isoform 1 | Pi4k2b | T8, S11 | AEACEPT*RPS*EDEDEEREPLLPR | NP_080227 | ||||
phosphatidylinositol 4-kinase type 3 alpha | Pi4ka | T988 | ITVPDT*YEAR | NP_001001983 | -4.74 | |||
catalytic phosphatidylinositol 4-kinase beta | Pi4kb | S496 | RLS*EQLAHTPTAFK | NP_780565 | 0.54 | 2.06 | ||
catalytic phosphatidylinositol 4-kinase beta | Pi4kb | S413 | S*VENLPECGITHEQR | NP_780565 | 0.05 | |||
catalytic phosphatidylinositol 4-kinase beta | Pi4kb | S294 | TAS*NPKVENEDEPVR | NP_780565 | 0.13 | 0.05 | ||
phosphoinositide-3-kinase adaptor protein 1 | Pik3ap1 | S494 | KFLEGNS*VKPASWER | NP_113553 | ||||
phosphatidylinositol transfer protein, membrane-associated 1 isoform 2 | Pitpnm1 | S621 | AS*PEPSALPAQR | NP_001129550 | 0.29 | |||
Pitpnm family member 3 isoform 1 | Pitpnm3 | S522, S530, S531, S533, S540 | GS*SHSDSSES*S*DS*LAPMGAS*R | NP_001020098 | ||||
Pitpnm family member 3 isoform 1 | Pitpnm3 | S892, S899 | S*RPKKNNS*R | NP_001020098 | ||||
ring finger protein 131 isoform a | Pja2 | T381 | VT*QRETER | NP_001020480 | ||||
polycystic kidney and hepatic disease 1-like 1 | Pkhd1l1 | Y3267 | NIKIVGDDY*SVLSKDSFGAR | NP_619615 | 2.98 | |||
polycystic kidney and hepatic disease 1-like 1 | Pkhd1l1 | S3268 | NIKIVGDDYS*VLSKDSFGAR | NP_619615 | 3.26 | |||
protein kinase N1 | Pkn1 | S8 | MAGDAVQS*EPR | NP_796236 | ||||
plakophilin 2 | Pkp2 | S132, S135 | AAAQYSS*QKS*VEER | NP_080439 | -2.18 | |||
plakophilin 2 | Pkp2 | S135 | AAAQYSSQKS*VEER | NP_080439 | -0.24 | |||
plakophilin 2 | Pkp2 | S151, S154 | LEIS*PDS*SPER | NP_080439 | ||||
plakophilin 2 | Pkp2 | S151, S155 | LEIS*PDSS*PER | NP_080439 | -0.18 | |||
plakophilin 2 | Pkp2 | S102 | LHVVENDFVGRQS*PVTR | NP_080439 | -1.06 | |||
plakophilin 2 | Pkp2 | S151, S154 | RLEIS*PDS*SPER | NP_080439 | 0.16 | |||
plakophilin 2 | Pkp2 | S151, S155 | RLEIS*PDSS*PER | NP_080439 | 0.17 | |||
plakophilin 2 | Pkp2 | S151 | RLEIS*PDSSPER | NP_080439 | 0.57 | |||
plakophilin 2 | Pkp2 | S264, S265, S268 | S*S*VRS*SLREPGR | NP_080439 | ||||
plakophilin 2 | Pkp2 | S82 | TSS*VPEYVYK | NP_080439 | -0.4 | -0.16 | -0.18 | |
plakophilin 4 isoform 1 | Pkp4 | S292 | RVGSVTS*R | NP_080637 | ||||
plakophilin 4 isoform 1 | Pkp4 | S336 | VASPSQGQVGSSS*PK | NP_080637 | 0.15 | |||
plakophilin 4 isoform 1 | Pkp4 | S313 | VGS*PLTLTDAQTR | NP_080637 | -0.4 | |||
cytosolic phospholipase A2, group IVA | Pla2g4a | S435 | HIVSNDSS*DSDDEAQGPK | NP_032895 | ||||
cytosolic phospholipase A2, group IVA | Pla2g4a | S437 | HIVSNDSSDS*DDEAQGPK | NP_032895 | -0.07 | -0.12 | ||
cytosolic phospholipase A2, group IVA | Pla2g4a | S723, S728, S730 | RQNPS*RCSVS*LS*NVEARK | NP_032895 | ||||
phospholipase C beta 3 | Plcb3 | S537 | S*LGEESLSR | NP_032900 | -0.79 | |||
plectin 1 isoform 12alpha | Plec1 | S728 | ARNDESQLS*PATR | NP_001157012 | 0.28 | |||
plectin 1 isoform 12alpha | Plec1 | T4037 | KQIT*VEELVR | NP_001157012 | -0.78 | -0.33 | -0.04 | |
plectin 1 isoform 12alpha | Plec1 | S4649 | RGS*FDATGSGF | NP_001157012 | 0.69 | 1.65 | ||
plectin 1 isoform 12alpha | Plec1 | S4649 | RGS*FDATGSGFSMTF | NP_001157012 | 0.92 | |||
plectin 1 isoform 12alpha | Plec1 | S4391 | S*SSVGSSSSYPISSAGPR | NP_001157012 | 0.34 | 0.32 | 0.36 | * |
plectin 1 isoform 12alpha | Plec1 | S4392 | SS*SVGSSSSYPISSAGPR | NP_001157012 | 0.32 | 0.33 | ||
plectin 1 isoform 12alpha | Plec1 | S4393, S4396 | SSS*VGS*SSSYPISSAGPR | NP_001157012 | 0.61 | |||
plectin 1 isoform 12alpha | Plec1 | S4393, S4397 | SSS*VGSS*SSYPISSAGPR | NP_001157012 | ||||
plectin 1 isoform 12alpha | Plec1 | S4393 | SSS*VGSSSSYPISSAGPR | NP_001157012 | -0.19 | 0.31 | 0.35 | |
plectin 1 isoform 12alpha | Plec1 | S4398 | SSSVGSSS*SYPISSAGPR | NP_001157012 | 0.22 | |||
plectin 1 isoform 1a | Plec1 | S21 | TSS*EDNLYLAVLR | NP_958796 | -0.24 | |||
phosphoinositol 3-phosphate-binding protein-2 | Plekha5 | S1243, T1256 | SLS*PSPDSSTAADPPT*PPQLR | NP_659169 | ||||
pleckstrin homology domain containing, family A member 6 isoform 2 | Plekha6 | S760 | KDPSQTS*PLGTPR | NP_001153740 | -0.28 | |||
pleckstrin homology domain containing, family A member 6 isoform 2 | Plekha6 | S468 | RLS*LQPR | NP_001153740 | ||||
pleckstrin homology domain containing, family A member 6 isoform 2 | Plekha6 | S797 | TKS*PAEEELTPSAVVR | NP_001153740 | -0.21 | |||
pleckstrin homology domain containing, family G (with RhoGef domain) member 3 | Plekhg3 | S433 | AWSS*QDEVSSHVR | NP_722499 | 0.22 | 0.72 | ||
pleckstrin homology domain containing, family G (with RhoGef domain) member 3 | Plekhg3 | S76 | GPLS*PFNGR | NP_722499 | -2.92 | |||
pleckstrin homology domain containing, family G (with RhoGef domain) member 3 | Plekhg3 | S502 | HAGS*AGALLDFGQPAHAQK | NP_722499 | 3.58 | |||
pleckstrin homology domain containing, family G (with RhoGef domain) member 3 | Plekhg3 | S862 | RES*LSYIPK | NP_722499 | 1.73 | |||
pleckstrin homology domain containing, family G (with RhoGef domain) member 3 | Plekhg3 | S1134, S1141 | RFS*FSPSAVS*PR | NP_722499 | 1.76 | |||
pleckstrin homology domain containing, family G (with RhoGef domain) member 3 | Plekhg3 | S1134 | RFS*FSPSAVSPR | NP_722499 | 1.83 | |||
pleckstrin homology domain containing, family G (with RhoGef domain) member 3 | Plekhg3 | S1141 | RFSFSPSAVS*PR | NP_722499 | ||||
pleckstrin homology domain containing, family G (with RhoGef domain) member 3 | Plekhg3 | S736, S737 | RS*S*LAIEDGK | NP_722499 | 1.98 | |||
pleckstrin homology domain containing, family G (with RhoGef domain) member 3 | Plekhg3 | S737 | RSS*LAIEDGK | NP_722499 | 0.57 | 0.78 | 0.08 | |
pleckstrin homology domain containing, family G (with RhoGef domain) member 3 | Plekhg3 | S1201 | S*LPENIVEPPMSGK | NP_722499 | 1.91 | |||
pleckstrin homology domain containing, family G (with RhoGef domain) member 3 | Plekhg3 | S571 | VPGPELPGS*EEEEEEEESLAVAEQGK | NP_722499 | -1.11 | 0.1 | ||
plexin A1 | Plxna1 | T444, S452 | EDGLTAVAAYDYQGRT*VVFAGTRS*GRIR | NP_032907 | ||||
promyelocytic leukemia isoform 1 | Pml | T481 | AT*SPPHLDGTSNPESTVPEKK | NP_032910 | -0.26 | 0.43 | ||
promyelocytic leukemia isoform 1 | Pml | S482 | ATS*PPHLDGTSNPESTVPEK | NP_032910 | 0.22 | |||
promyelocytic leukemia isoform 1 | Pml | S482 | ATS*PPHLDGTSNPESTVPEKK | NP_032910 | 0.11 | -0.14 | -0.06 | |
promyelocytic leukemia isoform 1 | Pml | T489 | ATSPPHLDGT*SNPESTVPEK | NP_032910 | 0.24 | |||
promyelocytic leukemia isoform 1 | Pml | S469 | LATSS*PEQSWPSTFK | NP_032910 | 0.77 | |||
promyelocytic leukemia isoform 1 | Pml | S17 | VPAPPGS*PCR | NP_032910 | 0.3 | -0.04 | 0.1 | |
pinin | Pnn | S66 | GFS*DSGGGPPAK | NP_032917 | -0.61 | -0.29 | 0.1 | |
pinin | Pnn | S100 | QES*DPEDDDVKKPALQSSVVATSK | NP_032917 | ||||
pinin | Pnn | S100 | QES*DPEDDDVKKPALQSSVVATSK | NP_032917 | 0.01 | -0.19 | -0.47 | |
pinin | Pnn | S66 | RGFS*DSGGGPPAK | NP_032917 | -0.02 | -0.47 | 0.49 | |
pinin | Pnn | S441 | S*LSPGKENINSQEVEK | NP_032917 | 0.41 | 0.05 | ||
pinin | Pnn | S443 | SLS*PGKENINSQEVEK | NP_032917 | 0.39 | -0.09 | 0.07 | |
pinin | Pnn | S443 | SLS*PGKENINSQEVEKESEEKEEK | NP_032917 | -0.27 | |||
polyribonucleotide nucleotidyltransferase 1 | Pnpt1 | S59, S60 | KLEIS*S*GKLAR | NP_082145 | ||||
pogo transposable element with ZNF domain | Pogz | S422 | SLDAEPSVPSAAKPSS*PEK | NP_766271 | 0.23 | |||
DNA-directed DNA polymerase alpha 2 | Pola2 | T127, T130 | VSST*PET*PLTK | NP_032919 | -1.25 | |||
DNA-directed DNA polymerase delta 3 | Pold3 | S305 | VDLS*DEEAKETEHLK | NP_598453 | -0.28 | |||
polymerase delta interacting protein 38 | Poldip2 | S27 | GS*RPLCAVGGAGGLPPVATATTRRHLSSR | NP_080665 | ||||
DNA polymerase theta isoform 2 | Polq | T706 | T*SLGINK | NP_001152841 | -0.06 | |||
DNA-directed RNA polymerase II A | Polr2a | T1874, T1881 | YSPT*SPTYSPT*SPK | NP_033115 | -0.06 | |||
DNA-directed RNA polymerase II A | Polr2a | S1875, T1881 | YSPTS*PTYSPT*SPK | NP_033115 | -0.16 | |||
DNA-directed RNA polymerase II A | Polr2a | S1875, S1882 | YSPTS*PTYSPTS*PK | NP_033115 | 0.42 | 0.04 | 0.3 | |
DNA-directed RNA polymerase II A | Polr2a | S1840, T1847 | YSPTS*PTYSPTT*PK | NP_033115 | -0.03 | |||
DNA-directed RNA polymerase II A | Polr2a | T1877, T1881 | YSPTSPT*YSPT*SPK | NP_033115 | -0.45 | |||
DNA-directed RNA polymerase II A | Polr2a | T1877, S1882 | YSPTSPT*YSPTS*PK | NP_033115 | 0.02 | 0.38 | ||
DNA-directed RNA polymerase II A | Polr2a | T1877 | YSPTSPT*YSPTSPK | NP_033115 | 0.27 | |||
DNA-directed RNA polymerase II A | Polr2a | Y1878, S1882 | YSPTSPTY*SPTS*PK | NP_033115 | ||||
DNA-directed RNA polymerase II A | Polr2a | T1881 | YSPTSPTYSPT*SPK | NP_033115 | 0.09 | |||
phosphatidic acid phosphatase type 2 domain containing 2 | Ppapdc2 | S67 | RGS*FPLAASGPAQAAPAPPPEDAR | NP_083198 | 1.89 | |||
peroxisome proliferator activated receptor gamma isoform 1 | Pparg | S287 | S*VEAVQEITEYAK | NP_001120802 | 0.16 | |||
protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein, alpha 1 | Ppfia1 | S239, S242 | RSS*DGS*LSHEDLAK | NP_001028491 | 0.35 | |||
protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein, alpha 1 | Ppfia1 | S1211 | VTSSMSS*PSMQPK | NP_001028491 | -2.92 | |||
PTPRF interacting protein, binding protein 1 (liprin beta 1) | Ppfibp1 | S753 | RRPS*DENSITPSEVQQWTNHR | NP_080497 | -0.15 | |||
PTPRF interacting protein, binding protein 1 (liprin beta 1) | Ppfibp1 | S558 | S*QSTTFNPDDMSEPEFK | NP_080497 | -0.16 | |||
PTPRF interacting protein, binding protein 1 (liprin beta 1) | Ppfibp1 | S560 | SQS*TTFNPDDMSEPEFK | NP_080497 | -0.11 | |||
PTPRF interacting protein, binding protein 1 (liprin beta 1) | Ppfibp1 | S355 | STSSTPGMGS*PSR | NP_080497 | -0.18 | |||
periphilin 1 isoform 3 | Pphln1 | S131 | DAS*PSSSSAVASSK | NP_001076583 | 0.45 | |||
peptidylprolyl isomerase G | Ppig | S395 | GDKSELNEIKENQRS*PVR | NP_001074555 | 0.08 | |||
peptidylprolyl isomerase G | Ppig | S354, T356 | S*ET*PPHWR | NP_001074555 | ||||
peptidylprolyl isomerase G | Ppig | S395 | SELNEIKENQRS*PVR | NP_001074555 | -0.14 | |||
peptidylprolyl isomerase G | Ppig | T356 | SET*PPHWR | NP_001074555 | 0.86 | |||
peptidylprolyl isomerase-like 2 | Ppil2 | S501 | SAEEEPSTS*TATPTAKK | NP_659203 | 3.75 | |||
peptidylprolyl isomerase-like 4 | Ppil4 | S178 | INHTVILDDPFDDPPDLLIPDRS*PEPTK | NP_080417 | 0.53 | |||
peptidylprolyl isomerase-like 4 | Ppil4 | T182 | INHTVILDDPFDDPPDLLIPDRSPEPT*K | NP_080417 | -0.04 | |||
periplakin | Ppl | Y13 | GKY*SPTVQTR | NP_032935 | ||||
periplakin | Ppl | S14 | GKYS*PTVQTR | NP_032935 | -3.25 | -1.73 | -1.75 | * |
periplakin | Ppl | S1655 | S*IVVIDPDTGR | NP_032935 | 0.13 | |||
protoporphyrinogen oxidase | Ppox | T250, S253, S261 | GVT*VLS*GQPVCGLS*LQPEGRWK | NP_032937 | <-10 | |||
protein phosphatase 1, catalytic subunit, alpha | Ppp1ca | T320 | YGQFSGLNPGGRPIT*PPR | NP_114074 | 0.31 | -0.22 | ||
protein phosphatase 1, catalytic subunit, beta isoform | Ppp1cb | T316 | YQYGGLNSGRPVT*PPR | NP_766295 | <-10 | |||
protein phosphatase 1, regulatory (inhibitor) subunit 12A | Ppp1r12a | S445 | KTGS*YGALAEISASK | NP_082168 | 0.45 | -0.2 | ||
protein phosphatase 1, regulatory (inhibitor) subunit 12A | Ppp1r12a | S507 | LAS*TSDIEEK | NP_082168 | -2.19 | |||
protein phosphatase 1, regulatory (inhibitor) subunit 12A | Ppp1r12a | S507 | RLAS*TSDIEEK | NP_082168 | -0.24 | |||
protein phosphatase 1, regulatory (inhibitor) subunit 12A | Ppp1r12a | S507 | RLAS*TSDIEEKENR | NP_082168 | -0.08 | |||
protein phosphatase 1, regulatory (inhibitor) subunit 12A | Ppp1r12a | T508 | RLAST*SDIEEK | NP_082168 | ||||
protein phosphatase 1, regulatory (inhibitor) subunit 12A | Ppp1r12a | S509 | RLASTS*DIEEK | NP_082168 | 4.41 | |||
protein phosphatase 1, regulatory (inhibitor) subunit 12A | Ppp1r12a | S509 | RLASTS*DIEEKENR | NP_082168 | -0.47 | |||
protein phosphatase 1, regulatory (inhibitor) subunit 12A | Ppp1r12a | S909 | SAS*YSYLEDR | NP_082168 | -0.04 | |||
protein phosphatase 1, regulatory (inhibitor) subunit 12A | Ppp1r12a | S870 | STGVSFWTQDSDENEQERQS*DTEDGSSKR | NP_082168 | -0.26 | |||
protein phosphatase 1, regulatory (inhibitor) subunit 12A | Ppp1r12a | T443 | T*GSYGALAEISASK | NP_082168 | 0.27 | -0.27 | -0.06 | |
protein phosphatase 1, regulatory (inhibitor) subunit 12A | Ppp1r12a | S445 | TGS*YGALAEISASK | NP_082168 | 0.32 | -0.17 | -0.63 | |
protein phosphatase 1, regulatory (inhibitor) subunit 12A | Ppp1r12a | Y446 | TGSY*GALAEISASK | NP_082168 | 0.27 | |||
apoptosis-stimulating protein of p53, 1 | Ppp1r13b | T671 | LPRPLSPT*K | NP_035755 | ||||
NFkB interacting protein 1 | Ppp1r13l | S187 | GS*PLAEGPQAFFPER | NP_001010836 | -3.48 | |||
NFkB interacting protein 1 | Ppp1r13l | S485 | SPAELEPEPELEVLLAPVEEAGDADEGTVTRPLS*PTR | NP_001010836 | 0.95 | |||
NFkB interacting protein 1 | Ppp1r13l | T487 | SPAELEPEPELEVLLAPVEEAGDADEGTVTRPLSPT*R | NP_001010836 | 0.4 | |||
protein phosphatase 1, regulatory (inhibitor) subunit 16A | Ppp1r16a | S72 | EVAGLRPRKHVLFPPS*VALLEAAAR | NP_203535 | ||||
protein phosphatase 1, regulatory (inhibitor) subunit 16B | Ppp1r16b | S333 | HKSSLS*RR | NP_001153134 | ||||
protein phosphatase 1, regulatory subunit 2 | Ppp1r2 | S122, S123 | EQES*S*GEEDNDLSPEER | NP_080076 | -0.01 | |||
protein phosphatase 1, regulatory subunit 2 | Ppp1r2 | Y87 | IDEPNTPYHNMIGDDEDAY*SDSEGNEVMTPDILAK | NP_080076 | 0.29 | |||
protein phosphatase 1, regulatory subunit 2 | Ppp1r2 | S88 | IDEPNTPYHNMIGDDEDAYS*DSEGNEVMTPDILAK | NP_080076 | 2.14 | |||
protein phosphatase 1, regulatory subunit 2 | Ppp1r2 | S122, S123 | TREQES*S*GEEDNDLSPEER | NP_080076 | -0.3 | |||
protein phosphatase 1, regulatory (inhibitor) subunit 3B | Ppp1r3b | S63 | KRVS*FADNQGLALTMVK | NP_808409 | ||||
protein phosphatase 1, regulatory subunit 9B | Ppp1r9b | S100 | ASS*LNENVDHSALLK | NP_758465 | 0.31 | |||
alpha isoform of regulatory subunit B55, protein phosphatase 2 | Ppp2r2a | T378 | NTKRDIT*LEASR | NP_082308 | ||||
delta isoform of regulatory subunit B56, protein phosphatase 2A | Ppp2r5d | S42 | DGGGENTDEAQPQPQS*QSPSSNK | NP_033384 | ||||
delta isoform of regulatory subunit B56, protein phosphatase 2A | Ppp2r5d | S46 | DGGGENTDEAQPQPQSQSPS*SNK | NP_033384 | -1.83 | |||
delta isoform of regulatory subunit B56, protein phosphatase 2A | Ppp2r5d | S47 | DGGGENTDEAQPQPQSQSPSS*NK | NP_033384 | -1.35 | |||
delta isoform of regulatory subunit B56, protein phosphatase 2A | Ppp2r5d | S565 | RKS*ELPQDVYTIK | NP_033384 | -1.41 | |||
delta isoform of regulatory subunit B56, protein phosphatase 2A | Ppp2r5d | S80 | RQS*SFPFNLNK | NP_033384 | 0.37 | |||
delta isoform of regulatory subunit B56, protein phosphatase 2A | Ppp2r5d | S81 | RQSS*FPFNLNK | NP_033384 | 0.36 | |||
protein phosphatase 4, regulatory subunit 2 | Ppp4r2 | S226 | GHSDSSASESEVSLLS*PVK | NP_891984 | -0.28 | 0.05 | ||
PQ loop repeat containing 1 | Pqlc1 | S116 | RRSFAATDS*KDEELR | NP_080137 | ||||
peroxiredoxin 2 | Prdx2 | T142 | QIT*VNDLPVGR | NP_035693 | ||||
AMP-activated protein kinase beta 1 non-catalytic subunit | Prkab1 | S174, S182 | CS*DVSELSSS*PPGPYHQEPY | NP_114075 | ||||
AMP-activated protein kinase beta 1 non-catalytic subunit | Prkab1 | S182 | CSDVSELSSS*PPGPYHQEPY | NP_114075 | ||||
AMP-activated protein kinase beta 1 non-catalytic subunit | Prkab1 | S182 | CSDVSELSSS*PPGPYHQEPYMSKPEER | NP_114075 | -0.6 | |||
AMP-activated protein kinase beta 1 non-catalytic subunit | Prkab1 | S108 | S*QNNFVAILDLPEGEHQYK | NP_114075 | -0.48 | |||
protein kinase, cAMP dependent, catalytic, alpha | Prkaca | T198 | TWT*LCGTPEYLAPEIILSK | NP_032880 | 0.45 | |||
protein kinase, cAMP dependent regulatory, type I, alpha | Prkar1a | S83 | EDEIS*PPPPNPVVK | NP_068680 | 0.11 | |||
protein kinase, cAMP dependent regulatory, type I, alpha | Prkar1a | T75 | T*DSREDEISPPPPNPVVK | NP_068680 | 0.26 | |||
protein kinase, cAMP dependent regulatory, type I, alpha | Prkar1a | S83 | TDSREDEIS*PPPPNPVVK | NP_068680 | 0.55 | 0.26 | ||
protein kinase, cAMP dependent regulatory, type II alpha | Prkar2a | S97 | RVS*VCAETFNPDEEEEDNDPR | NP_032950 | -0.8 | |||
protein kinase, cAMP dependent regulatory, type II beta | Prkar2b | S112 | RAS*VCAEAYNPDEEEDDAESR | NP_035288 | -0.83 | -0.17 | -0.66 | |
protein kinase C, delta | Prkcd | T505 | AST*FCGTPDYIAPEILQGLK | NP_035233 | -0.54 | |||
protein kinase C, delta | Prkcd | S643 | SPSDYSNFDPEFLNEKPQLS*FSDK | NP_035233 | 0.58 | |||
protein kinase C, iota | Prkci | T411 | EGLRPGDTTST*FCGTPN | NP_032883 | 0.65 | 0.05 | ||
protein kinase C, zeta isoform a | Prkcz | T5 | MPSRT*DPKMDRSGGR | NP_032886 | ||||
protein kinase D2 | Prkd2 | S197 | RLS*STSLASGHSVR | NP_849231 | 1.05 | |||
protein kinase D2 | Prkd2 | S200 | RLSSTS*LASGHSVR | NP_849231 | ||||
protein kinase, interferon inducible double stranded RNA dependent activator | Prkra | S18 | EDS*GTFSLGK | NP_036001 | -0.39 | |||
PRP3 pre-mRNA processing factor 3 homolog | Prpf3 | S619 | GDDDEES*DEEAVKK | NP_081817 | -0.29 | |||
PRP31 pre-mRNA processing factor 31 isoform 2 | Prpf31 | S426 | QS*VVYGGKSTIRDR | NP_001153186 | ||||
PRP38 pre-mRNA processing factor 38 (yeast) domain containing B | Prpf38b | S472, S478 | SGS*QGRTGS*VEKRK | NP_080121 | ||||
huntington yeast partner C | Prpf40b | S713, S721 | RSHSPS*VSRQGSES*DEEELPPPSLRPPKR | NP_061256 | ||||
PRP4 pre-mRNA processing factor 4 homolog B | Prpf4b | S88, S94 | EVIEAS*DKEGLS*PAKR | NP_038858 | 2.25 | |||
PRP4 pre-mRNA processing factor 4 homolog B | Prpf4b | S94 | EVIEASDKEGLS*PAKR | NP_038858 | -0.36 | -0.04 | ||
PRP4 pre-mRNA processing factor 4 homolog B | Prpf4b | Y849 | LCDFGSASHVADNDITPY*LVSR | NP_038858 | 0.36 | -0.17 | ||
PRP4 pre-mRNA processing factor 4 homolog B | Prpf4b | S366, S368 | S*RS*PLLNDR | NP_038858 | ||||
PRP4 pre-mRNA processing factor 4 homolog B | Prpf4b | S794, Y795 | S*Y*SQQLFLALKLLKR | NP_038858 | 3.5 | |||
PRP4 pre-mRNA processing factor 4 homolog B | Prpf4b | S431, S437 | SKDAS*PINRWS*PTR | NP_038858 | ||||
pre-mRNA processing factor 8 | Prpf8 | T2044 | EQSQLTATQT*R | NP_619600 | 9.3 | |||
phosphoribosyl pyrophosphate synthetase-associated protein 1 | Prpsap1 | S244 | LGLAVIHGEAQCTELDMDDGRHS*PPMVK | NP_080640 | 0.56 | |||
phosphoribosyl pyrophosphate synthetase-associated protein 2 | Prpsap2 | S227 | HS*PPMVR | NP_659055 | -0.42 | |||
phosphoribosyl pyrophosphate synthetase-associated protein 2 | Prpsap2 | S227 | LGIAVIHGEAQDAESDLVDGRHS*PPMVR | NP_659055 | 0.46 | |||
proline rich 8 | Prr8 | S816 | AKPLS*PEAQPK | NP_082510 | 0.37 | |||
transmembrane gamma-carboxyglutamic acid protein 4 | Prrg4 | S200, S202 | KHS*VS*PPPPYPGPAR | NP_848810 | ||||
proline-rich transmembrane protein 3 | Prrt3 | S192, S199, T212 | AETHITQAS*PWDFQGS*SHTPVPETDAVRT*LVLGK | NP_766075 | -2.44 | |||
pregnancy-specific glycoprotein 25 | Psg25 | T394, T395 | LVTQPVVRVTDT*T*VR | NP_473401 | 12.62 | |||
lens epithelium-derived growth factor | Psip1 | S129 | EDTDQEEKAS*NEDVTK | NP_598709 | 0.11 | |||
lens epithelium-derived growth factor | Psip1 | T122 | ETNVSKEDT*DQEEKASNEDVTK | NP_598709 | 0.07 | |||
lens epithelium-derived growth factor | Psip1 | S129 | ETNVSKEDTDQEEKAS*NEDVTK | NP_598709 | 0.07 | |||
lens epithelium-derived growth factor | Psip1 | T269, S274 | NLAKPGVT*STSDS*EDEDDQEGEK | NP_598709 | 0.09 | |||
lens epithelium-derived growth factor | Psip1 | S270, S274 | NLAKPGVTS*TSDS*EDEDDQEGEK | NP_598709 | 0.05 | |||
lens epithelium-derived growth factor | Psip1 | S272, S274 | NLAKPGVTSTS*DS*EDEDDQEGEK | NP_598709 | 0.06 | |||
lens epithelium-derived growth factor | Psip1 | S272, S274 | PGVTSTS*DS*EDEDDQEGEK | NP_598709 | 0.5 | |||
lens epithelium-derived growth factor | Psip1 | S105 | QSNAS*SDVEVEEKETNVSKEDTDQEEK | NP_598709 | -0.09 | |||
lens epithelium-derived growth factor | Psip1 | S106 | QSNASS*DVEVEEK | NP_598709 | 0.09 | |||
lens epithelium-derived growth factor | Psip1 | S106 | QSNASS*DVEVEEKETNVSKEDTDQEEK | NP_598709 | -0.11 | |||
proteasome (prosome, macropain) subunit, alpha type 3 | Psma3 | S250 | ESLKEEDES*DDDNM | NP_035314 | -0.4 | -0.1 | 0.1 | |
proteasome 26S non-ATPase subunit 1 | Psmd1 | T311, S315 | TASAVAGKT*PDAS*PEPK | NP_081633 | -0.39 | |||
proteasome 26S non-ATPase subunit 2 | Psmd2 | T9 | DKT*PVQSQQPSATTPSGADEK | NP_598862 | -0.23 | |||
proteasome 26S non-ATPase subunit 2 | Psmd2 | T20 | DKTPVQSQQPSATT*PSGADEK | NP_598862 | 0.43 | |||
proteasome 26S non-ATPase subunit 5 | Psmd5 | Y457, S466 | Y*ELVKALANS*K | NP_542121 | ||||
prostaglandin-E synthase 3 | Ptges3 | S113, S118 | DWEDDS*DEDMS*NFDR | NP_062740 | ||||
prostaglandin-E synthase 3 | Ptges3 | S113 | DWEDDS*DEDMSNFDR | NP_062740 | -0.03 | -0.22 | 0.03 | |
prostaglandin-E synthase 3 | Ptges3 | S118 | DWEDDSDEDMS*NFDR | NP_062740 | 0.15 | |||
protein tyrosine phosphatase-like A domain containing 1 | Ptplad1 | S114 | WLDES*DAEMELR | NP_067320 | 1.11 | |||
protein tyrosine phosphatase, non-receptor type 12 | Ptpn12 | S322 | IADGNEITTGTMVS*SIDSEKQDSPPPKPPR | NP_035333 | -0.45 | |||
protein tyrosine phosphatase, non-receptor type 12 | Ptpn12 | S331 | IADGNEITTGTMVSSIDSEKQDS*PPPKPPR | NP_035333 | 0.38 | -0.45 | ||
protein tyrosine phosphatase, non-receptor type 12 | Ptpn12 | S625, T626, T642 | NKTSIS*T*ASATVSPASSAESACT*R | NP_035333 | ||||
protein tyrosine phosphatase, non-receptor type 13 | Ptpn13 | S1456 | ERDPAGPQS*PPPDQDAQR | NP_035334 | -0.97 | |||
protein tyrosine phosphatase, non-receptor type 13 | Ptpn13 | S2059 | RACS*PDPLR | NP_035334 | -0.31 | |||
protein tyrosine phosphatase, non-receptor type 13 | Ptpn13 | S1073 | RWS*IVSSPER | NP_035334 | -0.31 | |||
protein tyrosine phosphatase, non-receptor type 14 | Ptpn14 | S314 | ICTEQSNS*PPPIR | NP_033002 | -0.12 | 0.09 | ||
protein tyrosine phosphatase, non-receptor type 14 | Ptpn14 | S646, S652 | RHS*LEVMNS*MVR | NP_033002 | ||||
protein tyrosine phosphatase, non-receptor type 14 | Ptpn14 | S646 | RHS*LEVMNSMVR | NP_033002 | -0.1 | |||
protein tyrosine phosphatase, non-receptor type 14 | Ptpn14 | S593, S594 | YVSGS*S*PDLVTR | NP_033002 | -0.35 | |||
protein tyrosine phosphatase, non-receptor type 14 | Ptpn14 | S594 | YVSGSS*PDLVTR | NP_033002 | -0.65 | |||
protein tyrosine phosphatase, non-receptor type 21 | Ptpn21 | S637 | RNS*IEIAGLTHGFEGLR | NP_001139671 | 0.51 | |||
protein tyrosine phosphatase, receptor type, K precursor | Ptprk | S868 | YLCEGTES*PYQTGQLHPAIR | NP_033009 | -1.17 | |||
pumilio 1 isoform 2 | Pum1 | S709 | RDS*LTGSSDLYK | NP_001153075 | 0.62 | |||
pumilio 1 isoform 2 | Pum1 | S709 | RDS*LTGSSDLYKR | NP_001153075 | 1.5 | |||
pumilio 2 isoform 1 | Pum2 | S136 | GKAS*PFEEDQNR | NP_001153691 | -0.06 | 0.15 | ||
pumilio 2 isoform 1 | Pum2 | S181 | QAS*PTEVVER | NP_001153691 | 0.49 | 0.66 | ||
purine rich element binding protein B | Purb | S113 | DSLGDFIEHYAQLGPSS*PEQLAAGAEEGGGPR | NP_035351 | 0.47 | |||
purine rich element binding protein B | Purb | S310 | GGGS*GGGDESEGEEVDED | NP_035351 | ||||
purine rich element binding protein B | Purb | S316 | GGGSGGGDES*EGEEVDED | NP_035351 | ||||
purine rich element binding protein B | Purb | S6, S8 | MADGDS*GS*ERGGGGGGGGGPGGFQPAPR | NP_035351 | ||||
purine rich element binding protein B | Purb | S6 | MADGDS*GSERGGGGGGGGGPGGFQPAPR | NP_035351 | ||||
purine rich element binding protein B | Purb | S6 | MADGDS*GSERGGGGGGGGGPGGFQPAPR | NP_035351 | ||||
purine rich element binding protein B | Purb | S8 | MADGDSGS*ERGGGGGGGGGPGGFQPAPR | NP_035351 | ||||
purine rich element binding protein B | Purb | S8 | MADGDSGS*ERGGGGGGGGGPGGFQPAPR | NP_035351 | ||||
purine rich element binding protein B | Purb | S310, S316 | RGGGS*GGGDES*EGEEVDED | NP_035351 | -0.06 | |||
purine rich element binding protein B | Purb | S316 | RGGGSGGGDES*EGEEVDED | NP_035351 | -0.27 | 0.28 | ||
pseudouridine synthase 1 isoform 1 | Pus1 | T440 | VPSSLEGSEGDGDT*D | NP_001020732 | ||||
pseudouridylate synthase 7 homolog (S. cerevisiae)-like | Pus7l | S110, T115 | ENS*VNSVT*SK | NP_766025 | ||||
periodic tryptophan protein 1 homolog | Pwp1 | S49 | LQEEGGS*EEEEAGNPSEDGMQSGPTQAPPR | NP_598754 | 0.22 | |||
periodic tryptophan protein 1 homolog | Pwp1 | S493 | S*PQQTPMES | NP_598754 | ||||
paxillin isoform alpha | Pxn | Y118 | AGEEEHVY*SFPNK | NP_035353 | -0.19 | |||
paxillin isoform alpha | Pxn | S287 | TGSS*SPPGGLSKPGSQLDSMLGSLQSDLNK | NP_035353 | 0.44 | |||
paxillin isoform alpha | Pxn | S288 | TGSSS*PPGGLSKPGSQLDSMLGSLQSDLNK | NP_035353 | -0.01 | |||
paxillin isoform alpha | Pxn | S83 | YAHQQPPS*PLPVYSSSAK | NP_035353 | -1.88 | |||
pyrroline-5-carboxylate reductase family, member 2 | Pycr2 | S278 | MADQEKVS*PAALK | NP_598466 | ||||
pygopus 2 | Pygo2 | T264 | GGGT*PDANSLAPPGK | NP_081145 | 0.3 | |||
R3H domain (binds single-stranded nucleic acids) | R3hdm1 | S881 | THS*PPQWK | NP_861415 | -0.13 | |||
R3H domain containing 2 | R3hdm2 | S37 | TPS*KEDVEKEGEENGLR | NP_082176 | -0.39 | |||
RAB11 family interacting protein 1 | Rab11fip1 | S780 | AGS*PESPHTEGTGQEPVTAEAQPNISSEGK | NP_001074282 | 0.09 | -0.67 | ||
RAB11 family interacting protein 1 | Rab11fip1 | S358 | HLFSS*TENLAAR | NP_001074282 | 0.26 | 0.16 | ||
RAB11 family interacting protein 1 | Rab11fip1 | T359 | HLFSST*ENLAAR | NP_001074282 | 0.55 | |||
RAB11 family interacting protein 5 (class I) isoform 1 | Rab11fip5 | S693 | RGS*NIWLEPK | NP_001003955 | 0.26 | 0.88 | ||
RAB11 family interacting protein 5 (class I) isoform 1 | Rab11fip5 | S307 | TYS*DEASQLR | NP_001003955 | 0.2 | 0.29 | 0.45 | |
RAB11 family interacting protein 5 (class I) isoform 1 | Rab11fip5 | S311 | TYSDEAS*QLR | NP_001003955 | ||||
RAB12, member RAS oncogene family | Rab12 | S20 | RPAGGSLGAVS*PALSGGQAR | NP_077768 | -1.19 | -1.21 | ||
RAB25, member RAS oncogene family | Rab25 | T58 | TVMLGT*AAVK | NP_058595 | ||||
Rab40b, member RAS oncogene family | Rab40b | S266 | TIRPPQS*PPR | NP_631886 | 0.23 | |||
RAB GTPase activating protein 1 isoform b | Rabgap1 | S37 | QGDETPS*TNNGSDDEKTGLK | NP_001029132 | -0.01 | |||
RAB GTPase activating protein 1 isoform b | Rabgap1 | T38 | QGDETPST*NNGSDDEKTGLK | NP_001029132 | 0.13 | |||
RAB GTPase activating protein 1 isoform b | Rabgap1 | S42 | QGDETPSTNNGS*DDEKTGLK | NP_001029132 | 0.36 | 0.36 | ||
ankycorbin | Rai14 | S413 | S*SPPVEHPAGTSTTDNDVIIR | NP_109615 | 0.23 | |||
ankycorbin | Rai14 | S414 | SS*PPVEHPAGTSTTDNDVIIR | NP_109615 | 0.33 | |||
ralA binding protein 1 | Ralbp1 | S29 | TPS*SEEISPTK | NP_033093 | 0.21 | -0.09 | 0 | |
ralA binding protein 1 | Ralbp1 | S29 | TPS*SEEISPTKFPGLYR | NP_033093 | -0.39 | |||
ralA binding protein 1 | Ralbp1 | S30 | TPSS*EEISPTK | NP_033093 | -0.09 | 0 | ||
ralA binding protein 1 | Ralbp1 | S30 | TPSS*EEISPTKFPGLYR | NP_033093 | -0.39 | |||
Ral-A exchange factor RalGPS2 | Ralgps2 | T368 | SAT*FPNAGPR | NP_001153437 | 0.32 | |||
hnRNP-associated with lethal yellow short isoform | Raly | T276, S278, T288 | DDGDEEGLLT*HS*EEELEHSQDT*DAEDGALQ | NP_001132983 | ||||
hnRNP-associated with lethal yellow short isoform | Raly | S278 | DDGDEEGLLTHS*EEELEHSQDTDAEDGALQ | NP_001132983 | ||||
hnRNP-associated with lethal yellow short isoform | Raly | S119 | GRLS*PVPVPR | NP_001132983 | -0.33 | -0.02 | 0.28 | |
hnRNP-associated with lethal yellow short isoform | Raly | T252, S254, T258 | LPAPQEDT*AS*EAGT*PQGEVQTR | NP_001132983 | -0.19 | |||
hnRNP-associated with lethal yellow short isoform | Raly | T252, T258 | LPAPQEDT*ASEAGT*PQGEVQTR | NP_001132983 | 0.05 | -0.08 | -0.01 | |
hnRNP-associated with lethal yellow short isoform | Raly | T252 | LPAPQEDT*ASEAGTPQGEVQTR | NP_001132983 | 0.94 | |||
hnRNP-associated with lethal yellow short isoform | Raly | S254, T258 | LPAPQEDTAS*EAGT*PQGEVQTR | NP_001132983 | 0.25 | -0.1 | -0.06 | |
hnRNP-associated with lethal yellow short isoform | Raly | S254 | LPAPQEDTAS*EAGTPQGEVQTR | NP_001132983 | 0.9 | 0.35 | 0.02 | |
hnRNP-associated with lethal yellow short isoform | Raly | T258 | LPAPQEDTASEAGT*PQGEVQTR | NP_001132983 | -0.56 | -1.05 | 0.96 | |
hnRNP-associated with lethal yellow short isoform | Raly | T265 | LPAPQEDTASEAGTPQGEVQT*R | NP_001132983 | ||||
RAN binding protein 1 | Ranbp1 | S60 | FAS*ENDLPEWK | NP_035369 | -0.71 | |||
RAN binding protein 2 | Ranbp2 | S2087 | EDALDDSVSSSSVHASPLAS*SPVRK | NP_035370 | -0.72 | |||
RAN binding protein 2 | Ranbp2 | S2088 | EDALDDSVSSSSVHASPLASS*PVRK | NP_035370 | -0.23 | -0.72 | ||
RAN binding protein 2 | Ranbp2 | S954 | ESPATGILS*PR | NP_035370 | 3.64 | |||
RAN binding protein 2 | Ranbp2 | S2641 | HSSSS*PVSGTMDKPVDLSTR | NP_035370 | 0.09 | |||
RAN binding protein 2 | Ranbp2 | S2505 | NRPGYVS*EEEEDDEDYEMAVK | NP_035370 | 0.18 | |||
RAN binding protein 2 | Ranbp2 | S1154 | SHETDGGS*AHGDEEDDGPHFEPVVPLPDK | NP_035370 | -0.03 | -0.44 | ||
RAN binding protein 2 | Ranbp2 | S788 | YSLS*PSK | NP_035370 | <-10 | |||
RAN binding protein 3 | Ranbp3 | S463 | ATEEEDS*DEDAVLAPSGVTGAGTGDEGDGQAPGST | NP_082209 | ||||
RAN binding protein 3 | Ranbp3 | S146 | S*PSESAEETHTLEEK | NP_082209 | -0.08 | -0.1 | ||
RAN binding protein 3 | Ranbp3 | S148 | SPS*ESAEETHTLEEK | NP_082209 | -0.08 | |||
RAN binding protein 3 | Ranbp3 | S150 | SPSES*AEETHTLEEK | NP_082209 | ||||
RAN binding protein 3 | Ranbp3 | S257 | VLS*PPKLNEANSDTSR | NP_082209 | 0.02 | |||
Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 | Raph1 | Y470, S476 | RY*FLLRAS*GIYYVPK | NP_001038978 | ||||
Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 | Raph1 | T190 | T*ASAGTVSDAEAR | NP_001038978 | 0.52 | |||
Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 | Raph1 | S192 | TAS*AGTVSDAEAR | NP_001038978 | 0.54 | 0.91 | ||
RAS p21 protein activator 3 | Rasa3 | S317 | SADVEPVS*ASAAHILGEVCR | NP_033051 | ||||
RAS protein activator like 1 (GAP1 like) | Rasal1 | T95 | ISLSKEAIT*ADPR | NP_038860 | ||||
Raver1 | Raver1 | S626 | HKMS*PPPSSFNEPR | NP_082187 | 0.04 | -0.13 | ||
Raver1 | Raver1 | S576 | LLS*PIASNR | NP_082187 | -0.75 | |||
Raver1 | Raver1 | S14 | MAADVSVTHRPPLS*PEAEAEAETPETVDR | NP_082187 | ||||
retinoblastoma binding protein 6 isoform 1 | Rbbp6 | S862 | PSANREDFS*PER | NP_035377 | 0.32 | 0.23 | ||
retinoblastoma binding protein 6 isoform 1 | Rbbp6 | S1179 | VEGTEIVKPS*PK | NP_035377 | 0.11 | -0.81 | ||
RNA binding motif protein 10 | Rbm10 | S723 | LASDDRPS*PPR | NP_663602 | 0.03 | 0.16 | 0.22 | |
RNA binding motif protein 12B | Rbm12b | S683 | RVS*VEDLR | NP_082502 | 0.13 | -0.32 | ||
RNA binding motif protein 14 | Rbm14 | T206 | QPT*PPFFGR | NP_063922 | 0 | 0.07 | -0.02 | |
RNA binding motif protein 14 | Rbm14 | S618 | RLS*ESQLSFR | NP_063922 | 0.98 | |||
RNA binding motif protein 14 | Rbm14 | S620 | RLSES*QLSFR | NP_063922 | ||||
RNA binding motif protein 14 | Rbm14 | T572 | SQGAVANANST*PPPYER | NP_063922 | -0.44 | |||
RNA binding motif protein 14 | Rbm14 | S582 | TRLS*PPR | NP_063922 | 0.22 | 1.45 | ||
RNA binding motif protein 15 | Rbm15 | T567 | DRT*PPLLYR | NP_001039272 | -0.18 | 0.06 | 0.14 | |
RNA binding motif protein 15 | Rbm15 | S655 | HLDRS*PESERPR | NP_001039272 | ||||
RNA binding motif protein 15 | Rbm15 | S658 | HLDRSPES*ERPR | NP_001039272 | ||||
RNA binding motif protein 15 | Rbm15 | S127 | LHSYSS*PSTK | NP_001039272 | -1.05 | |||
RNA binding motif protein 15 | Rbm15 | S291 | S*LSPGGAALGYR | NP_001039272 | ||||
RNA binding motif protein 15 | Rbm15 | S293 | SLS*PGGAALGYR | NP_001039272 | 0.31 | 0.17 | 0.08 | |
RNA binding motif protein 16 | Rbm16 | S617 | ASEPVKEPVQTAQS*PAPVEK | NP_598884 | 0.19 | -0.08 | 0.06 | |
RNA binding motif protein 17 | Rbm17 | S155 | RPDPDS*DEDEDYER | NP_690037 | -0.14 | 0.86 | ||
RNA binding motif protein 17 | Rbm17 | S155 | RPDPDS*DEDEDYERER | NP_690037 | 0.12 | |||
RNA binding motif protein 25 | Rbm25 | S670 | LGAS*NSPGQPNSVK | NP_081625 | ||||
RNA binding motif protein 25 | Rbm25 | S672 | LGASNS*PGQPNSVK | NP_081625 | -0.12 | -0.2 | -0.22 | * |
RNA binding motif protein 25 | Rbm25 | S672 | LGASNS*PGQPNSVKR | NP_081625 | -0.22 | |||
RNA binding motif protein 39 | Rbm39 | S136 | DKS*PVREPIDNLTPEER | NP_573505 | 0.37 | -0.23 | -0.03 | |
RNA binding motif protein 39 | Rbm39 | T146 | DKSPVREPIDNLT*PEER | NP_573505 | ||||
RNA binding motif protein 39 | Rbm39 | S136 | KDKS*PVREPIDNLTPEER | NP_573505 | 0.29 | |||
RNA binding motif protein 39 | Rbm39 | Y95 | Y*RSPYSGPK | NP_573505 | 0 | 0.05 | 0.52 | |
RNA binding motif protein 39 | Rbm39 | S97 | YRS*PYSGPK | NP_573505 | -0.26 | -0.03 | -0.05 | |
RNA binding motif protein 39 | Rbm39 | Y99 | YRSPY*SGPK | NP_573505 | ||||
RNA binding motif protein 39 | Rbm39 | S100 | YRSPYS*GPK | NP_573505 | ||||
RNA binding motif protein 5 | Rbm5 | S59 | DYDS*PERER | NP_683732 | -0.22 | |||
RNA binding motif protein 5 | Rbm5 | S624 | GLVAAYSGDS*DNEEELVER | NP_683732 | -0.24 | |||
RNA binding motif protein 6 isoform a | Rbm6 | T632 | EGLT*FRR | NP_035381 | ||||
RNA binding motif protein 8a isoform a | Rbm8a | Y54 | MREDY*DSVEQDGDEPGPQR | NP_001095877 | 0.29 | |||
RNA binding motif protein, X chromosome retrogene | Rbmxrt | S205 | DVYLS*PR | NP_033059 | -0.15 | 0.01 | 0.41 | |
RNA binding motif protein, X chromosome retrogene | Rbmxrt | S205 | RDVYLS*PR | NP_033059 | ||||
RD RNA-binding protein | Rdbp | S135, S139, S140 | KSLYES*FVSS*S*DR | NP_001039328 | ||||
RD RNA-binding protein | Rdbp | S247 | RSDS*FPER | NP_001039328 | 0.31 | |||
RD RNA-binding protein | Rdbp | S49 | S*LSEQPVVDTATATEQAK | NP_001039328 | -0.53 | |||
RD RNA-binding protein | Rdbp | S51 | SLS*EQPVVDTATATEQAK | NP_001039328 | -0.37 | |||
RD RNA-binding protein | Rdbp | S115 | SMS*ADEDLQEPSR | NP_001039328 | -0.5 | -0.42 | 0.25 | |
alcohol dehydrogenase PAN2 | Rdh14 | S179, S180, S183 | S*S*APS*RIVVVSSKLYK | NP_076186 | 5.43 | 5.38 | ||
RAS-like GTP binding protein Rem | Rem1 | T19, S24 | AST*PLPLS*SR | NP_033073 | -0.35 | |||
RalBP1 associated Eps domain containing 1 isoform 2 | Reps1 | S681 | LKS*EDELRPDVDEHTQK | NP_001104535 | -0.16 | -0.44 | ||
RalBP1 associated Eps domain containing 1 isoform 2 | Reps1 | S272 | RQS*SSYEDPWK | NP_001104535 | 1.17 | 1.13 | ||
RalBP1 associated Eps domain containing 1 isoform 2 | Reps1 | S274 | RQSSS*YEDPWK | NP_001104535 | 2.13 | |||
RalBP1 associated Eps domain containing 1 isoform 2 | Reps1 | T454 | TSSDHTNPT*SPLLVKPSDLSEENK | NP_001104535 | -0.6 | |||
arginine glutamic acid dipeptide (RE) repeats | Rere | S1258 | PHVMS*PTNR | NP_001078961 | -0.8 | |||
RE1-silencing transcription factor | Rest | S848 | SAQDPPAPPS*PSPK | NP_035393 | 0.27 | |||
RNA (guanine-9-) methyltransferase domain containing 2 | Rg9mtd2 | T23 | LGT*SDGEEERQEPR | NP_780598 | 0.27 | |||
RNA (guanine-9-) methyltransferase domain containing 2 | Rg9mtd2 | S24 | LGTS*DGEEER | NP_780598 | -0.68 | 0.41 | ||
RNA (guanine-9-) methyltransferase domain containing 2 | Rg9mtd2 | S24 | LGTS*DGEEERQEPR | NP_780598 | 0.36 | 0.29 | ||
RalGDS-like protein 3 | Rgl3 | S707 | EGTGHTLSAS*PT | NP_076111 | ||||
RalGDS-like protein 3 | Rgl3 | S553, S556 | EKNSSPGGSPGDPSSPTSSVSPGS*PPS*SPR | NP_076111 | -0.7 | |||
RalGDS-like protein 3 | Rgl3 | S553, S557 | EKNSSPGGSPGDPSSPTSSVSPGS*PPSS*PR | NP_076111 | -0.7 | |||
RalGDS-like protein 3 | Rgl3 | S568, S572, S577 | NREPPPPGS*PPAS*PGPQS*PSTK | NP_076111 | -1.58 | |||
RalGDS-like protein 3 | Rgl3 | S568, S572 | NREPPPPGS*PPAS*PGPQSPSTK | NP_076111 | -0.03 | -0.98 | ||
RalGDS-like protein 3 | Rgl3 | S568, S577 | NREPPPPGS*PPASPGPQS*PSTK | NP_076111 | -0.98 | |||
RalGDS-like protein 3 | Rgl3 | S568, S579 | NREPPPPGS*PPASPGPQSPS*TK | NP_076111 | -0.75 | |||
RalGDS-like protein 3 | Rgl3 | S568 | NREPPPPGS*PPASPGPQSPSTK | NP_076111 | 1.89 | 0.04 | 0.1 | |
RalGDS-like protein 3 | Rgl3 | S506 | VIEPPAAS*CPSSPR | NP_076111 | ||||
RalGDS-like protein 3 | Rgl3 | S506, S509 | VIEPPAAS*CPS*SPR | NP_076111 | 0.02 | -0.59 | ||
RalGDS-like protein 3 | Rgl3 | S506, S510 | VIEPPAAS*CPSS*PR | NP_076111 | 0.75 | 0 | -0.7 | |
RalGDS-like protein 3 | Rgl3 | S509, S510 | VIEPPAASCPS*S*PR | NP_076111 | 0.75 | 0.02 | -0.72 | |
RalGDS-like protein 3 | Rgl3 | S509 | VIEPPAASCPS*SPR | NP_076111 | -0.28 | -0.11 | 0.12 | |
RalGDS-like protein 3 | Rgl3 | S510 | VIEPPAASCPSS*PR | NP_076111 | -0.28 | -0.02 | 0.12 | |
regulator of G-protein signalling 12 isoform B | Rgs12 | S574 | LPAGSSELALS*SPPPVKGYSKR | NP_001156984 | ||||
mitochondrial Rho 1 isoform 2 | Rhot1 | S251, S257 | KHLS*DGVADS*GLTLR | NP_001156826 | ||||
rhophilin, Rho GTPase binding protein 2 | Rhpn2 | S642 | KLSFLS*WGTSK | NP_082173 | -0.33 | |||
rhophilin, Rho GTPase binding protein 2 | Rhpn2 | S652 | S*ASTLCLPEVGLAR | NP_082173 | 0.96 | |||
rhophilin, Rho GTPase binding protein 2 | Rhpn2 | S654 | SAS*TLCLPEVGLAR | NP_082173 | 0.93 | -0.43 | ||
synembryn | Ric8 | S451, T456 | AS*INPVT*GRVEEKPPNPMEGMTEEQK | NP_444424 | ||||
Ras and Rab interactor 1 | Rin1 | S446 | RLS*ADGSLGRLAEGFR | NP_663470 | ||||
Ras and Rab interactor 2 | Rin2 | Y646 | LIY*TVMENNSGR | NP_083000 | 3.67 | |||
receptor (TNFRSF)-interacting serine-threonine kinase 1 | Ripk1 | S313 | EYPDQS*PVLQR | NP_033094 | -0.94 | |||
ribonuclease, RNase A family, 9 (non-active) | Rnase9 | Y47, S49 | DFIREY*ES*TGPTKPPTVK | NP_898853 | ||||
ring finger protein 113A2 | Rnf113a2 | T168, S169, S175 | DT*S*MGNASS*GMVR | NP_079801 | ||||
ring finger protein 138 isoform 2 | Rnf138 | Y96 | IKFY*RMR | NP_062680 | ||||
E3 ubiquitin-protein ligase BRE1B | Rnf40 | Y676 | EMKLLLDMY*KSAPK | NP_758485 | 5.98 | |||
RNA (guanine-7-) methyltransferase | Rnmt | S11, S15 | ASVAS*DPES*PPGGNEPAAASGQR | NP_080716 | -0.08 | |||
ribonucleic acid binding protein S1 isoform 1 | Rnps1 | S251 | RFS*PPR | NP_001073596 | 0.27 | |||
roundabout 1 | Robo1 | S1489 | SSDRKGGS*YK | NP_062286 | ||||
ROD1 regulator of differentiation 1 isoform 1 | Rod1 | S55 | FKGDRPPCS*PSR | NP_659153 | 0.7 | |||
ROD1 regulator of differentiation 1 isoform 1 | Rod1 | S55 | GDRPPCS*PSR | NP_659153 | -0.12 | |||
RNA polymerase II associated protein 3 | Rpap3 | S429 | AVDNPPRGS*PK | NP_082279 | -0.16 | |||
retinal pigment epithelium 65 | Rpe65 | Y368 | Y*VLPLTIDK | NP_084263 | ||||
ribosomal protein L12 | Rpl12 | T18 | CT*GGEVGATSALAPK | NP_033102 | ||||
ribosomal protein L22 like 1 | Rpl22l1 | S118 | YFQISQDEDGS*ESED | NP_080793 | ||||
ribosomal protein L22 like 1 | Rpl22l1 | S120 | YFQISQDEDGSES*ED | NP_080793 | ||||
ribosomal protein L23a | Rpl23a | S43 | IRTS*PTFR | NP_997406 | -5.33 | 0.4 | ||
ribosomal protein L34 isoform 2 | Rpl34 | Y32 | TPGNRIVY*LYTKKVGKAPK | NP_001005859 | ||||
ribosomal protein L4 | Rpl4 | S295 | ILKS*PEIQR | NP_077174 | -0.07 | -0.03 | ||
ribosomal protein L7 | Rpl7 | Y79, Y87 | HY*HKEYRQMY*R | NP_035421 | ||||
ribosomal protein, large, P0 | Rplp0 | S304, S307 | AEAKEES*EES*DEDMGFGLFD | NP_031501 | 0.14 | 0.02 | ||
ribosomal protein, large, P1 | Rplp1 | S101, S104 | KEES*EES*EDDMGFGLFD | NP_061341 | 0.27 | -0.23 | -0.03 | |
ribosomal protein, large, P1 | Rplp1 | S101 | KEES*EESEDDMGFGLFD | NP_061341 | -0.3 | |||
ribosomal protein, large, P1 | Rplp1 | S104 | KEESEES*EDDMGFGLFD | NP_061341 | -0.26 | |||
ribosomal protein, large P2 | Rplp2 | S102, S105 | KEES*EES*DDDMGFGLFD | NP_080296 | 0.56 | 1.14 | -0.05 | |
regulation of nuclear pre-mRNA domain containing 1B | Rprd1b | S134 | LSMEDSKS*PPPK | NP_081710 | 0.44 | 0.02 | ||
regulation of nuclear pre-mRNA domain containing 1B | Rprd1b | S134 | LSMEDSKS*PPPKAEEK | NP_081710 | -0.35 | -0.58 | ||
regulation of nuclear pre-mRNA domain containing 2 | Rprd2 | S749 | S*GTPTQDEMMDKPTSSSVDTMSLLSK | NP_001074762 | 0 | |||
regulation of nuclear pre-mRNA domain containing 2 | Rprd2 | T751 | SGT*PTQDEMMDKPTSSSVDTMSLLSK | NP_001074762 | 0.02 | |||
ribosomal protein S28 | Rps28 | S23 | TGS*QGQCTQVR | NP_058540 | -1.26 | |||
ribosomal protein S3 | Rps3 | T221 | DEILPTT*PISEQK | NP_036182 | 0.3 | -0.16 | 0.4 | |
ribosomal protein S6 | Rps6 | S236, S240 | LSS*LRAS*TSK | NP_033122 | 0.52 | |||
ribosomal protein S6 | Rps6 | S236, S240 | LSS*LRAS*TSKSESSQK | NP_033122 | 1.71 | |||
ribosomal protein S6 kinase, polypeptide 1 isoform 1 | Rps6kb1 | S441, T444 | RFIGS*PRT*PVSPVK | NP_001107806 | ||||
ribosomal protein S6 kinase, 52kDa, polypeptide 1 | Rps6kc1 | S145 | ESRSLFPS*SLKPR | NP_848890 | ||||
repetin | Rptn | Y875 | TRRDSY*VEQSGR | NP_033126 | ||||
raptor | Rptor | S859, S863 | ILDTSSLTQS*APAS*PTNK | NP_083174 | 0.15 | -0.79 | ||
raptor | Rptor | S722 | SVSS*YGNIR | NP_083174 | -0.25 | |||
small GTPase homolog | Rragc | S94 | MSPNETLFLES*TNK | NP_059503 | 0.73 | |||
related RAS viral (r-ras) oncogene homolog 2 | Rras2 | S186 | KFQEQECPPS*PEPTR | NP_080122 | 0.46 | -0.03 | ||
related RAS viral (r-ras) oncogene homolog 2 | Rras2 | T190 | KFQEQECPPSPEPT*R | NP_080122 | 0.34 | |||
ribosome binding protein 1 isoform a | Rrbp1 | S662, S677 | S*EMAPAQGQKASMVQS*QEAPK | NP_077243 | ||||
ras responsive element binding protein 1 isoform 1 | Rreb1 | S1368 | AVEGPS*PSPEPEEKPAESLAIDPTPGTR | NP_001013410 | 0.87 | |||
ras responsive element binding protein 1 isoform 1 | Rreb1 | S1370 | AVEGPSPS*PEPEEKPAESLAIDPTPGTR | NP_001013410 | 3.96 | |||
novel nuclear protein 1 | Rrp1 | S434 | EAGS*EAESSSADPGPGR | NP_035055 | 0.43 | 0.08 | ||
novel nuclear protein 1 | Rrp1 | S438 | EAGSEAES*SSADPGPGR | NP_035055 | -0.5 | |||
ribosomal RNA processing 8, methyltransferase, homolog | Rrp8 | S234 | SDSQES*RAGALR | NP_080173 | ||||
U3 snoRNP-associated protein | Rrp9 | S470 | LPVS*PVAGS | NP_663595 | ||||
U3 snoRNP-associated protein | Rrp9 | S470 | RLPVS*PVAGS | NP_663595 | 0.9 | 0.34 | 0.16 | |
remodeling and spacing factor 1 | Rsf1 | T1308, S1312 | IET*DEES*CDNAHGDADQPAR | NP_001074736 | 0.12 | |||
remodeling and spacing factor 1 | Rsf1 | T1308 | IET*DEESCDNAHGDADQPAR | NP_001074736 | -0.3 | 0 | ||
radial spokehead-like 2B | Rshl2b | T16, Y17 | TAEASGLYT*Y*SSRPR | NP_001077414 | ||||
arginine/serine-rich coiled-coil 2 isoform 3 | Rsrc2 | T161 | T*PSPPPFRGR | NP_001005523 | ||||
arginine/serine-rich coiled-coil 2 isoform 1 | Rsrc2 | T16 | DGLALEKT*SPDREK | NP_001005525 | -0.01 | |||
arginine/serine-rich coiled-coil 2 isoform 1 | Rsrc2 | S17 | DGLALEKTS*PDREK | NP_001005525 | 0.79 | |||
arginine/serine-rich coiled-coil 2 isoform 1 | Rsrc2 | S32 | EQSDISIS*PR | NP_001005525 | 0.33 | 0.02 | 0.04 | |
arginine/serine-rich coiled-coil 2 isoform 1 | Rsrc2 | S30 | KKEQSDIS*ISPR | NP_001005525 | 0.07 | |||
arginine/serine-rich coiled-coil 2 isoform 1 | Rsrc2 | S32 | KKEQSDISIS*PR | NP_001005525 | -0.64 | |||
RNA terminal phosphate cyclase domain 1 | Rtcd1 | T157, Y160 | T*RGY*YPKGGGEVIVR | NP_079793 | ||||
rhotekin isoform a | Rtkn | S106 | RPS*DSVQPAQHSPCR | NP_001129699 | 3.52 | |||
rhotekin isoform a | Rtkn | S520 | TFS*LDAAPADHSLGPSR | NP_001129699 | ||||
reticulon 4 isoform B1 | Rtn4 | T98 | GPLPAAPPT*APERQPSWER | NP_918941 | 0.77 | |||
reticulon 4 isoform A | Rtn4 | S165 | RGS*GSVDETLFALPAASEPVIPSSAEK | NP_918943 | 0.37 | |||
reticulon 4 isoform A | Rtn4 | T171 | RGSGSVDET*LFALPAASEPVIPSSAEK | NP_918943 | 0.77 | |||
RUN and SH3 domain containing 1 isoform 2 | Rusc1 | S261, S262, T265, S267 | KTDENTNS*S*LKT*ES*GKLASCLNTNSGSK | NP_001077276 | ||||
RING1 and YY1 binding protein | Rybp | S99 | DKDIS*PSVTK | NP_062717 | 3.08 | |||
serum amyloid A-like 1 | Saal1 | S14 | MDRNPSPPPPTCGS*EDEEDLGGGDR | NP_084509 | ||||
scaffold attachment factor B | Safb | S626 | SVVS*FDKVK | NP_001156772 | -0.71 | |||
scaffold attachment factor B2 | Safb2 | S387 | APTAALS*PEPQDSK | NP_001025150 | -0.15 | 0.07 | -0.06 | |
scaffold attachment factor B2 | Safb2 | S387 | APTAALS*PEPQDSKEDVK | NP_001025150 | 0.13 | -0.17 | -0.17 | |
scaffold attachment factor B2 | Safb2 | S387 | APTAALS*PEPQDSKEDVKK | NP_001025150 | 0.14 | -0.3 | -0.21 | |
retinal S-antigen | Sag | S10 | S*HVIFKKVSR | NP_033144 | ||||
sterile alpha motif domain containing 1 | Samd1 | S150 | AAAATAPPS*PGPAQPGPR | NP_001074884 | -1.72 | |||
SAM domain- and HD domain-containing protein 1 isoform 2 | Samhd1 | T310 | EQIMGPPIT*PVKDSLWPYK | NP_001132992 | 0.05 | 0.51 | ||
SAM domain- and HD domain-containing protein 1 isoform 2 | Samhd1 | S315 | EQIMGPPITPVKDS*LWPYK | NP_001132992 | ||||
SAM domain- and HD domain-containing protein 1 isoform 2 | Samhd1 | T52, S55 | T*PPS*TPPATANLSADDDFQNTDLR | NP_001132992 | -0.07 | |||
SAM domain- and HD domain-containing protein 1 isoform 2 | Samhd1 | T52, T56 | T*PPST*PPATANLSADDDFQNTDLR | NP_001132992 | 0.23 | -0.36 | ||
SAM domain- and HD domain-containing protein 1 isoform 2 | Samhd1 | T52, T60 | T*PPSTPPAT*ANLSADDDFQNTDLR | NP_001132992 | 0.04 | -0.05 | ||
SAM domain- and HD domain-containing protein 1 isoform 2 | Samhd1 | T52 | T*PPSTPPATANLSADDDFQNTDLR | NP_001132992 | 0.22 | -0.2 | ||
SAM domain- and HD domain-containing protein 1 isoform 2 | Samhd1 | S55, T56 | TPPS*T*PPATANLSADDDFQNTDLR | NP_001132992 | 0.22 | -0.45 | ||
SAM domain- and HD domain-containing protein 1 isoform 2 | Samhd1 | S55, T60 | TPPS*TPPAT*ANLSADDDFQNTDLR | NP_001132992 | -0.23 | -0.36 | ||
SAM domain- and HD domain-containing protein 1 isoform 2 | Samhd1 | S55 | TPPS*TPPATANLSADDDFQNTDLR | NP_001132992 | -0.2 | |||
SAM domain- and HD domain-containing protein 1 isoform 2 | Samhd1 | T56, T60 | TPPST*PPAT*ANLSADDDFQNTDLR | NP_001132992 | -0.17 | |||
SAPS domain family, member 3 | Saps3 | S588 | IQQFDDGGS*DEEDIWEEK | NP_083732 | 0.12 | 0.06 | -0.18 | |
seryl-tRNA synthetase | Sars | S427 | KNNLRFS*TQNK | NP_035449 | 9.16 | |||
SR-related CTD-associated factor 1 | Scaf1 | S676, S682 | APS*PAPAVS*PK | NP_001008422 | -0.16 | -0.01 | 0.05 | |
SR-related CTD-associated factor 1 | Scaf1 | S240 | FDIYDPFHPTDEAYS*PPPAPEQK | NP_001008422 | 0.08 | -0.45 | ||
SR-related CTD-associated factor 1 | Scaf1 | S491, S493 | S*AS*PGPPPAR | NP_001008422 | -0.05 | |||
sciellin | Scel | S343 | GKS*LDNLIK | NP_075024 | -0.37 | -0.22 | 0.59 | |
sciellin | Scel | S287 | GNQAFGS*LK | NP_075024 | ||||
sciellin | Scel | T122, T128, T129 | TPAVSSFNANTTAT*ASTPAT*T*PVKKK | NP_075024 | ||||
sciellin | Scel | T125, T128 | TPAVSSFNANTTATAST*PAT*TPVKK | NP_075024 | -1.65 | |||
sciellin | Scel | T125, T129 | TPAVSSFNANTTATAST*PATT*PVKK | NP_075024 | -1.63 | |||
sciellin | Scel | Y88 | Y*RSEDMLDR | NP_075024 | -0.1 | |||
sciellin | Scel | S90 | YRS*EDMLDR | NP_075024 | -1.19 | -0.1 | ||
Sec1 family domain containing 1 | Scfd1 | S294 | VNLEES*TGVENSPAGARPK | NP_084101 | -0.24 | |||
Sec1 family domain containing 1 | Scfd1 | T295 | VNLEEST*GVENSPAGARPK | NP_084101 | -0.13 | |||
Sec1 family domain containing 1 | Scfd1 | S300 | VNLEESTGVENS*PAGARPK | NP_084101 | -0.52 | |||
sodium channel, voltage-gated, type XI, alpha | Scn11a | S963 | KS*DAASMLSECSTIDLNDIFR | NP_036017 | ||||
sodium channel, voltage-gated, type IX, alpha | Scn9a | T553 | RSSRT*SLFSFKGR | NP_061340 | ||||
sodium channel, voltage-gated, type IX, alpha | Scn9a | T301, Y304, Y306, Y307, S311 | VKT*MGY*FY*Y*LEGS*K | NP_061340 | ||||
PDZ-domain protein scribble | Scrib | S1518 | MKS*LEQDALR | NP_598850 | -0.04 | 0.15 | ||
PDZ-domain protein scribble | Scrib | S1485 | MQS*PELPAPER | NP_598850 | 0.15 | |||
PDZ-domain protein scribble | Scrib | S1206 | NS*LESISSIDR | NP_598850 | 0.25 | |||
PDZ-domain protein scribble | Scrib | S506 | RNEAFVCKPDPSPPS*PSEEEK | NP_598850 | -0.27 | |||
PDZ-domain protein scribble | Scrib | S508 | RNEAFVCKPDPSPPSPS*EEEK | NP_598850 | 0.21 | |||
PDZ-domain protein scribble | Scrib | S1389 | RVS*LVGADDLR | NP_598850 | 2.3 | 0.72 | 0.79 | |
PDZ-domain protein scribble | Scrib | S1389 | RVS*LVGADDLRK | NP_598850 | 0.37 | |||
D10Ertd802e protein | Scyl2 | S677 | RGS*LTLEEK | NP_932138 | 1.9 | 3.07 | ||
SDA1 domain containing 1 | Sdad1 | S657 | KQKNFMMMRYS*QNVR | NP_766301 | ||||
serologically defined colon cancer antigen 1 | Sdccag1 | S1020, S1024 | KGKAAKTALNS*FMHS*K | NP_079717 | 5.52 | |||
SEC16 homolog A | Sec16a | S2101 | APS*LTSDSEGKKPAQAVK | NP_694765 | 0.15 | |||
SEC16 homolog A | Sec16a | S1245 | ASHYS*DQLAPR | NP_694765 | -0.79 | |||
SEC16 homolog A | Sec16a | S1028 | MYS*PSPSDGPASQQPLPNHPR | NP_694765 | -0.59 | -0.91 | ||
SEC16 homolog A | Sec16a | S1032 | MYSPSPS*DGPASQQPLPNHPR | NP_694765 | -0.84 | |||
SEC16 homolog A | Sec16a | S1384 | SS*LSSHSHQSQIYR | NP_694765 | ||||
SEC16 homolog A | Sec16a | S1239 | YSEPERPSS*R | NP_694765 | -0.14 | |||
SEC22 vesicle trafficking protein-like 1 | Sec22b | S137 | NLGS*INTELQDVQR | NP_035472 | 21.66 | 7.45 | ||
Sec24 related gene family, member B | Sec24b | S1207 | DSRPLS*PVLHLVK | NP_997092 | ||||
Sec61 beta subunit | Sec61b | S7 | PGPTPS*GTNVGSSGRSPSK | NP_077133 | ||||
Sec61 beta subunit | Sec61b | S13 | PGPTPSGTNVGS*SGRSPSK | NP_077133 | 0.6 | |||
Sec61 beta subunit | Sec61b | S17 | PGPTPSGTNVGSSGRS*PSK | NP_077133 | 0.8 | 0.05 | 0.65 | |
Sec61 beta subunit | Sec61b | S19 | PGPTPSGTNVGSSGRSPS*K | NP_077133 | 0.99 | 0.53 | ||
translocation protein 1 | Sec62 | T375 | EELEQQT*DGDCDEEDDDKDGEVPK | NP_081292 | 1.18 | -0.22 | ||
semaphorin 4D | Sema4d | S598 | AAS*PKYGFVGRK | NP_038688 | ||||
sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A | Sema6a | S184, Y198, T209 | LYS*ATVTDFLAIDAVIY*RSLGDSPTLRT*VKHDSK | NP_061214 | ||||
semenogelin I | Semg1 | S266, S272 | S*YGQQKS*LK | NP_059086 | ||||
septin 2 a | Sept2 | S218 | IYHLPDAES*DEDEDFKEQTR | NP_001153189 | 0.78 | -0.13 | -0.13 | |
septin 4 | Sept4 | S325 | IYQFPDCDS*DEDEDFKLQDQALK | NP_035259 | 0.26 | |||
septin 9 isoform a | Sept9 | T143 | AEVLGHKT*PEPVPR | NP_001106958 | -3.19 | |||
septin 9 isoform a | Sept9 | S85 | LVDSLSQRS*PKPSLR | NP_001106958 | -2.38 | |||
septin 9 isoform a | Sept9 | S89 | LVDSLSQRSPKPS*LR | NP_001106958 | -2.6 | |||
septin 9 isoform a | Sept9 | T49 | RVQT*PLLR | NP_001106958 | -3.13 | |||
septin 9 isoform a | Sept9 | S30 | S*FEVEEIEPPNSTPPR | NP_001106958 | -0.94 | -0.01 | -0.11 | |
septin 9 isoform a | Sept9 | S30 | S*FEVEEIEPPNSTPPRR | NP_001106958 | -0.34 | |||
SERPINE1 mRNA binding protein 1 isoform 2 | Serbp1 | S323 | SKS*EEAHAEDSVMDHHFR | NP_001107036 | -1.2 | 0.16 | ||
serine (or cysteine) proteinase inhibitor, clade A, member 3N | Serpina3n | S300 | NS*LKPRMIDELHLPK | NP_033278 | ||||
SET domain containing 5 | Setd5 | S760 | HYIRFGS*PFMPERR | NP_082661 | ||||
senataxin | Setx | S1517, S1525, T1527 | EDSLS*RPQLESLS*IT*K | NP_932150 | ||||
senataxin | Setx | S1227, T1230 | VPAS*KAT*KKTHSDTR | NP_932150 | -2.09 | |||
splicing factor 1 isoform 1 | Sf1 | S80, S82 | S*PS*PEPIYNSEGK | NP_001104261 | -0.13 | 0.14 | ||
splicing factor 1 isoform 1 | Sf1 | S80, S82 | TGDLGIPPNPEDRS*PS*PEPIYNSEGK | NP_001104261 | 0.22 | -0.12 | ||
splicing factor 3a, subunit 3 | Sf3a3 | S292, S295 | GKS*LES*LDTSLFAKNPKSK | NP_083433 | ||||
splicing factor 3b, subunit 1 | Sf3b1 | T326, T328 | GGDSIGET*PT*PGASK | NP_112456 | 0.52 | |||
splicing factor 3b, subunit 1 | Sf3b1 | T223, T227 | KLSSWDQAET*PGHT*PSLR | NP_112456 | ||||
splicing factor 3b, subunit 1 | Sf3b1 | T223, S229 | KLSSWDQAET*PGHTPS*LR | NP_112456 | 0.15 | |||
splicing factor 3b, subunit 1 | Sf3b1 | S194 | VVNGAAASQPPS*KR | NP_112456 | 0.68 | |||
splicing factor 3b, subunit 1 | Sf3b1 | T235 | WDET*PGR | NP_112456 | 0.39 | |||
splicing factor 3b, subunit 1 | Sf3b1 | T207, T211 | WDQTADQT*PGAT*PK | NP_112456 | 0.13 | |||
splicing factor 3b, subunit 2 | Sf3b2 | T743 | SSVPAGMET*PELIELR | NP_084385 | -0.27 | |||
splicing factor 3b, subunit 3 | Sf3b3 | T1200, S1205 | NVSEELDRT*PPEVS*K | NP_598714 | ||||
splicing factor 4 | Sf4 | S483 | ALQQHQHGYDS*DEEVDSELGTWEHQLR | NP_081757 | 0.33 | |||
Sfi1 homolog, spindle assembly associated | Sfi1 | T873 | FT*AGTKAFR | NP_084483 | ||||
stratifin | Sfn | T136 | YLAEVAT*GDDKK | NP_061224 | ||||
splicing factor proline/glutamine rich (polypyrimidine tract binding protein associated) | Sfpq | T468 | ERET*PPR | NP_076092 | 0.41 | |||
splicing factor, arginine/serine-rich 1 isoform 1 | Sfrs1 | S199, S201 | VDGPRS*PS*YGR | NP_775550 | 0.15 | |||
splicing factor, arginine/serine-rich 1 isoform 1 | Sfrs1 | S199, Y202 | VDGPRS*PSY*GR | NP_775550 | 1.25 | |||
splicing factor, arginine/serine-rich 1 isoform 1 | Sfrs1 | S199 | VDGPRS*PSYGR | NP_775550 | -0.02 | 1.08 | ||
splicing factor, arginine/serine-rich 1 isoform 1 | Sfrs1 | S201 | VDGPRSPS*YGR | NP_775550 | 0.94 | |||
splicing factor, arginine/serine-rich 1 isoform 1 | Sfrs1 | S199, S201 | VKVDGPRS*PS*YGR | NP_775550 | -0.22 | |||
splicing factor, arginine/serine-rich 1 isoform 1 | Sfrs1 | S199, Y202 | VKVDGPRS*PSY*GR | NP_775550 | 0 | |||
splicing factor, arginine/serine-rich 1 isoform 1 | Sfrs1 | S199 | VKVDGPRS*PSYGR | NP_775550 | 0.06 | |||
splicing factor, arginine/serine-rich 11 isoform 2 | Sfrs11 | S462 | DYDEEEQGYDS*EKEK | NP_001087221 | 0.09 | 0.05 | ||
splicing factor, arginine/serine-rich 11 isoform 2 | Sfrs11 | S462 | DYDEEEQGYDS*EKEKKEEK | NP_001087221 | -0.26 | |||
splicing factor, arginine/serine-rich 11 isoform 2 | Sfrs11 | S235 | LNHVAAGLVS*PSLK | NP_001087221 | -0.64 | -0.39 | ||
splicing factor, arginine/serine-rich 11 isoform 2 | Sfrs11 | S477 | RPTEAVS*PK | NP_001087221 | -0.08 | |||
splicing factor, arginine/serine-rich 11 isoform 2 | Sfrs11 | T353 | SKT*PPKSYSTAR | NP_001087221 | 0.58 | |||
splicing factor, arginine/serine-rich 11 isoform 2 | Sfrs11 | S510 | VNGDDHHEEDMDMS*D | NP_001087221 | ||||
splicing factor, arginine/serine-rich 12 | Sfrs12 | S486 | VQHNGNCQPNEES*PCSK | NP_766180 | 0.43 | -0.13 | ||
splicing factor, arginine/serine-rich 12 | Sfrs12 | S489 | VQHNGNCQPNEESPCS*K | NP_766180 | 0.05 | |||
splicing factor, arginine/serine-rich 16 isoform L | Sfrs16 | S285 | KIS*PPSYAR | NP_057889 | 0.04 | 0.13 | ||
Talia | Sfrs17b | S646, T649 | S*QKT*GKINYAKEFTK | NP_001075425 | ||||
splicing factor, arginine/serine-rich 2 | Sfrs2 | S206, S208, S212 | S*KS*PPKS*PEEEGAVSS | NP_035488 | -0.09 | |||
splicing factor, arginine/serine-rich 2 | Sfrs2 | S206, S208, S212, S221 | S*KS*PPKS*PEEEGAVSS* | NP_035488 | -0.01 | |||
splicing factor, arginine/serine-rich 2 | Sfrs2 | S142 | SRS*RYSRSKSRSRTRSR | NP_035488 | ||||
splicing factor, arginine/serine-rich 2 | Sfrs2 | T25 | VDNLTYRT*SPDTLR | NP_035488 | 0.32 | |||
splicing factor, arginine/serine-rich 2 | Sfrs2 | S26 | VDNLTYRTS*PDTLR | NP_035488 | 0.05 | |||
splicing factor, arginine/serine-rich 2 | Sfrs2 | S26 | VDNLTYRTS*PDTLRR | NP_035488 | 0.01 | |||
splicing factor, arginine/serine-rich 2, interacting protein | Sfrs2ip | S857, S859 | ETVVESQSSQS*PS*PK | NP_082424 | -0.1 | |||
splicing factor, arginine/serine-rich 2, interacting protein | Sfrs2ip | S821, S827 | FHS*PSTTWS*PNKDAAQEK | NP_082424 | 0.03 | |||
splicing factor, arginine/serine-rich 2, interacting protein | Sfrs2ip | S821 | FHS*PSTTWSPNK | NP_082424 | 0.02 | 0.07 | ||
splicing factor, arginine/serine-rich 2, interacting protein | Sfrs2ip | S823 | FHSPS*TTWSPNK | NP_082424 | 0.01 | |||
splicing factor, arginine/serine-rich 2, interacting protein | Sfrs2ip | T825 | FHSPSTT*WSPNK | NP_082424 | -0.07 | |||
splicing factor, arginine/serine-rich 2, interacting protein | Sfrs2ip | S857, S859 | RETVVESQSSQS*PS*PK | NP_082424 | 0.13 | |||
splicing factor, arginine/serine-rich 2, interacting protein | Sfrs2ip | S857, S859 | RETVVESQSSQS*PS*PKR | NP_082424 | -0.28 | |||
splicing factor, arginine/serine-rich 2, interacting protein | Sfrs2ip | S857 | RETVVESQSSQS*PSPK | NP_082424 | 0.2 | 0.06 | ||
splicing factor, arginine/serine-rich 2, interacting protein | Sfrs2ip | S859 | RETVVESQSSQSPS*PK | NP_082424 | -0.1 | 0 | ||
splicing factor, arginine/serine-rich 4 | Sfrs4 | S385 | KHSSKRDS*K | NP_065612 | ||||
arginine/serine-rich splicing factor 6 | Sfrs6 | S303 | SHS*PLPAPPSK | NP_080775 | -0.35 | -0.07 | 0.11 | |
splicing factor, arginine/serine-rich 8 | Sfrs8 | S601 | VKLDDDS*EEDEESR | NP_758480 | -0.42 | |||
splicing factor, arginine/serine rich 9 | Sfrs9 | S212 | GS*PHYFSPFRPY | NP_079849 | 0.55 | 0.13 | ||
splicing factor, arginine/serine rich 9 | Sfrs9 | Y215 | GSPHY*FSPFRPY | NP_079849 | 0.09 | |||
splicing factor, arginine/serine rich 9 | Sfrs9 | S217 | GSPHYFS*PFRPY | NP_079849 | 0.35 | |||
splicing factor, arginine/serine rich 9 | Sfrs9 | Y193 | STSYGY*SR | NP_079849 | 0.2 | |||
splicing factor, arginine/serine rich 9 | Sfrs9 | S194 | STSYGYS*R | NP_079849 | 0.2 | |||
shugoshin-like 2 | Sgol2 | S373 | S*KKNQNKK | NP_950172 | -12.66 | |||
small glutamine-rich tetratricopeptide repeat (TPR) containing protein | Sgta | T82 | APDRT*PPSEEDSAEAER | NP_078775 | 0.32 | -0.16 | ||
small glutamine-rich tetratricopeptide repeat (TPR) containing protein | Sgta | S85 | APDRTPPS*EEDSAEAER | NP_078775 | -0.14 | |||
small glutamine-rich tetratricopeptide repeat (TPR) containing protein | Sgta | S307 | TPS*ASHEEQQE | NP_078775 | ||||
SH2B adaptor protein 3 | Sh2b3 | S517, S523, S525 | DS*DYDMDS*SS*R | NP_032533 | ||||
SH3-domain binding protein 1 | Sh3bp1 | T534 | ERTEADLPKPT*SPK | NP_033190 | -0.32 | |||
SH3-domain binding protein 1 | Sh3bp1 | S535 | ERTEADLPKPTS*PK | NP_033190 | -0.86 | |||
SH3-domain binding protein 1 | Sh3bp1 | S535 | TEADLPKPTS*PK | NP_033190 | ||||
SH3-domain GRB2-like 1 | Sh3gl1 | S287 | ITASS*SFR | NP_038692 | -0.27 | -0.56 | ||
SH3-domain GRB2-like 1 | Sh3gl1 | S288 | ITASSS*FR | NP_038692 | 0.04 | -0.44 | ||
SH3 and PX domains 2A | Sh3pxd2a | S420 | AQISS*PNLR | NP_032044 | -1.89 | |||
SH3 and PX domains 2A | Sh3pxd2a | S592 | RIS*PASSLQR | NP_032044 | -0.47 | 0.19 | ||
src homology 2 domain-containing transforming protein C3 | Shc3 | Y259 | EQTY*YQGR | NP_033193 | 3.74 | |||
sonic hedgehog | Shh | S191 | AHIHCSVKAENS*VAAK | NP_033196 | -4.17 | |||
soc-2 (suppressor of clear) homolog | Shoc2 | T205 | FNRIT*TVEKDIK | NP_062632 | ||||
shroom isoform 2 | Shroom3 | T1464, S1472 | KT*HAEPQKTS*EDIR | NP_001071063 | ||||
shroom isoform 2 | Shroom3 | S1044 | SKS*AEDLLER | NP_001071063 | -0.46 | |||
shroom family member 4 | Shroom4 | S657 | ARS*SECLSQASESSK | NP_001035549 | 1.8 | |||
shroom family member 4 | Shroom4 | S658 | ARSS*ECLSQASESSK | NP_001035549 | 1.05 | |||
shroom family member 4 | Shroom4 | S658 | SS*ECLSQASESSK | NP_001035549 | 0.36 | |||
signal-induced proliferation-associated 1 like 1 | Sipa1l1 | S286 | EREKPLKRRS*K | NP_766167 | ||||
signal-induced proliferation-associated 1 like 1 | Sipa1l1 | S1528 | LIDLES*PTPESQK | NP_766167 | -0.17 | |||
signal-induced proliferation-associated 1 like 1 | Sipa1l1 | S1421 | S*SPKEELHPTASSQLAPSFSSSSSSSSGPR | NP_766167 | -0.28 | |||
signal-induced proliferation-associated 1 like 1 | Sipa1l1 | S1564 | TLS*DESIYSSQR | NP_766167 | 0.26 | 0.13 | 0 | |
signal-induced proliferation-associated 1 like 3 | Sipa1l3 | S94 | EQSNPS*PSQDTDGVK | NP_001074497 | -0.51 | -0.49 | ||
superkiller viralicidic activity 2-like | Skiv2l | S253 | ASS*LEDLVLK | NP_067312 | 0.12 | 0 | 5.63 | |
superkiller viralicidic activity 2-like 2 | Skiv2l2 | S606 | NS*EEQYNK | NP_082427 | ||||
stem-loop binding protein | Slbp | S7 | S*PPGYGSR | NP_033219 | -0.05 | |||
peptide transporter 2 isoform 1 | Slc15a2 | S387 | CGVNFSS*LR | NP_067276 | 1.27 | |||
solute carrier family 15, member 4 | Slc15a4 | S299 | HSLFDS*CK | NP_598656 | -1.02 | |||
solute carrier family 16, member 1 | Slc16a1 | S477 | AAQS*PQQHSSGDPTEEESPV | NP_033222 | ||||
solute carrier family 16, member 1 | Slc16a1 | S482 | AAQSPQQHS*SGDPTEEESPV | NP_033222 | ||||
solute carrier family 16, member 1 | Slc16a1 | S483 | AAQSPQQHSS*GDPTEEESPV | NP_033222 | ||||
solute carrier family 16, member 1 | Slc16a1 | S491 | AAQSPQQHSSGDPTEEES*PV | NP_033222 | ||||
solute carrier family 16, member 1 | Slc16a1 | S461 | EGKEDEAS*TDVDEKPK | NP_033222 | -0.29 | |||
solute carrier family 16, member 1 | Slc16a1 | T462 | EGKEDEAST*DVDEKPK | NP_033222 | ||||
solute carrier family 16, member 1 | Slc16a1 | S210, S213 | LKS*KES*LQEAGK | NP_033222 | -0.33 | |||
solute carrier family 16, member 1 | Slc16a1 | S213 | SKES*LQEAGKSDANTDLIGGSPK | NP_033222 | 0.06 | |||
solute carrier family 1 (glutamate/neutral amino acid transporter), member 4 | Slc1a4 | Y10 | GY*LDGTQAEPAAGPR | NP_061349 | -0.2 | |||
prestin | Slc26a5 | S400, T406 | S*LVQEGT*GGK | NP_109652 | ||||
solute carrier family 30 (zinc transporter), member 1 | Slc30a1 | S502 | NVPNKQPESS*L | NP_033605 | -0.24 | |||
solute carrier family 33 (acetyl-CoA transporter), member 1 | Slc33a1 | S42 | RDS*VGGEGDREVLLGDAGPGDLPK | NP_056543 | 0.88 | 1.54 | ||
solute carrier family 4, sodium bicarbonate cotransporter-like, member 10 | Slc4a10 | T765 | LQVPSVFKPT*RDDR | NP_291030 | ||||
solute carrier family 4, sodium bicarbonate cotransporter, member 4 isoform b | Slc4a4 | S255 | NLTS*SSLNDISDKPEKDQLK | NP_001129732 | 0.3 | |||
solute carrier family 4, sodium bicarbonate cotransporter, member 4 isoform b | Slc4a4 | S257 | NLTSSS*LNDISDKPEKDQLK | NP_001129732 | 0.05 | |||
solute carrier family 4, sodium bicarbonate cotransporter, member 7 | Slc4a7 | S421, S424 | IEPPKS*VPS*QEK | NP_001028442 | ||||
solute carrier family 6 member 9 | Slc6a9 | S16, T19 | GMLNGAVPS*EAT*KKDQNLTR | NP_032161 | 11.02 | |||
solute carrier family 9 (sodium/hydrogen exchanger), member 1 | Slc9a1 | S707 | IGS*DPLAYEPK | NP_058677 | 1.43 | |||
solute carrier family 9 (sodium/hydrogen exchanger), member 1 | Slc9a1 | S697 | LDS*PTLSR | NP_058677 | 0.59 | 0.13 | 0.19 | |
solute carrier family 9 (sodium/hydrogen exchanger), member 1 | Slc9a1 | S790 | SKEPSSPGTDDVFTPGSSDS*PSSQR | NP_058677 | 0.24 | |||
solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1 | Slc9a3r1 | S273 | EALVEPAS*ESPRPALAR | NP_036160 | ||||
solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1 | Slc9a3r1 | S275 | EALVEPASES*PRPALAR | NP_036160 | -1.76 | -1.83 | -1.85 | * |
solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1 | Slc9a3r1 | S275 | EALVEPASES*PRPALARS | NP_036160 | ||||
solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1 | Slc9a3r1 | S283, S297 | S*ASSDTSEELNSQDS*PKR | NP_036160 | -0.18 | |||
solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1 | Slc9a3r1 | S283 | S*ASSDTSEELNSQDSPK | NP_036160 | 0.26 | -0.23 | -0.01 | |
solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1 | Slc9a3r1 | S283 | S*ASSDTSEELNSQDSPKR | NP_036160 | -0.09 | |||
solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1 | Slc9a3r1 | S285, S297 | SAS*SDTSEELNSQDS*PK | NP_036160 | -0.13 | |||
solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1 | Slc9a3r1 | S285, S297 | SAS*SDTSEELNSQDS*PKR | NP_036160 | -0.35 | -0.17 | ||
solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1 | Slc9a3r1 | S285 | SAS*SDTSEELNSQDSPK | NP_036160 | -0.09 | -0.15 | 0.16 | |
solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1 | Slc9a3r1 | S285 | SAS*SDTSEELNSQDSPKR | NP_036160 | 1.27 | -0.02 | ||
solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1 | Slc9a3r1 | S286 | SASS*DTSEELNSQDSPK | NP_036160 | 3.55 | |||
solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1 | Slc9a3r1 | T288 | SASSDT*SEELNSQDSPK | NP_036160 | 3.54 | |||
solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1 | Slc9a3r1 | S289 | SASSDTS*EELNSQDSPK | NP_036160 | -0.33 | |||
solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1 | Slc9a3r1 | S294 | SASSDTSEELNS*QDSPKR | NP_036160 | -0.82 | |||
solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1 | Slc9a3r1 | S297 | SASSDTSEELNSQDS*PKR | NP_036160 | 0.67 | -0.24 | ||
serine/threonine kinase 2 | Slk | S189 | RDS*FIGTPYWMAPEVVMCETSK | NP_033315 | -0.56 | |||
modulator of estrogen induced transcription isoform a | Sltm | S289 | DVQDAIAQS*PEK | NP_079966 | 0.12 | -0.26 | -0.17 | |
modulator of estrogen induced transcription isoform a | Sltm | S358, S364 | SSSKES*KDSKTS*SK | NP_079966 | ||||
step II splicing factor SLU7 | Slu7 | S215 | LVEQANS*PK | NP_683514 | -0.19 | |||
MAD homolog 1 | Smad1 | S70 | CVTIPRS* | NP_032565 | ||||
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a4 | Smarca4 | T1390 | DSEAGSST*PTTSTR | NP_035547 | -0.74 | |||
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 | Smarca5 | T55 | GGPEGGAAPAAPCAAGSGPADT*EMEEVFDHGSPGK | NP_444354 | 0.43 | |||
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 | Smarca5 | S65 | GGPEGGAAPAAPCAAGSGPADTEMEEVFDHGS*PGK | NP_444354 | 0.32 | -0.37 | -0.03 | |
SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin, subfamily a, containing DEAD/H box 1 | Smarcad1 | S79 | KAS*LSCFQNQR | NP_031984 | 1.78 | |||
SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin, subfamily a, containing DEAD/H box 1 | Smarcad1 | S81 | KASLS*CFQNQR | NP_031984 | 3.38 | |||
SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin, subfamily a, containing DEAD/H box 1 | Smarcad1 | S212 | RKLSSS*SEEDDVNDDQSVKQPR | NP_031984 | ||||
SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin, subfamily a, containing DEAD/H box 1 | Smarcad1 | S213 | RKLSSSS*EEDDVNDDQSVKQPR | NP_031984 | ||||
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 | Smarcc1 | S327, S329 | KPS*PS*PPPPTATESR | NP_033237 | 0.36 | |||
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 | Smarcc1 | S309 | NEEPVRS*PER | NP_033237 | -0.59 | |||
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 | Smarcc1 | S327, S329 | RKPS*PS*PPPPTATESR | NP_033237 | 0 | -0.11 | ||
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 | Smarcc1 | S327 | RKPS*PSPPPPTATESR | NP_033237 | ||||
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 | Smarcc1 | S327 | RKPS*PSPPPPTATESR | NP_033237 | -0.02 | 0.16 | ||
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 | Smarcc1 | S329 | RKPSPS*PPPPTATESR | NP_033237 | ||||
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin c2 isoform 2 | Smarcc2 | S347 | DMDEPS*PVPNVEEVTLPK | NP_001107568 | 0.18 | |||
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin c2 isoform 2 | Smarcc2 | S273, S283, S286 | KIS*AKTLTDEVNS*PDS*DR | NP_001107568 | ||||
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin c2 isoform 2 | Smarcc2 | S283 | TLTDEVNS*PDSDRR | NP_001107568 | -0.4 | |||
chondroitin sulfate proteoglycan 6 | Smc3 | S1067 | KGDVEGSQS*QDEGEGSGESER | NP_031816 | 0.02 | -0.14 | ||
SMC hinge domain containing 1 | Smchd1 | Y403, S408, S410 | Y*INTAS*DS*FEFK | NP_083163 | ||||
hypothetical protein LOC239555 | Smcr7l | S55, S59 | AIS*APTS*PTR | NP_848834 | -0.68 | |||
Smith-Magenis syndrome chromosome region, candidate 8 homolog isoform 1 | Smcr8 | Y437 | SSVESVLIKMEQELGDEEY*TGVEATEAR | NP_001078909 | ||||
SMEK homolog 1, suppressor of mek1 isoform 2 | Smek1 | S741 | TNLSGRQS*PSFK | NP_001153686 | -0.43 | |||
smoothelin | Smtn | T127 | VRAQEIKAAT*LAGR | NP_001152756 | 32.6 | |||
smoothelin-like 2 | Smtnl2 | S129 | S*PSVEHDEASDLEVR | NP_808444 | 0.53 | |||
smoothelin-like 2 | Smtnl2 | S250 | SLS*GSGYGAVTAGK | NP_808444 | -0.34 | |||
smoothelin-like 2 | Smtnl2 | S131 | SPS*VEHDEASDLEVR | NP_808444 | 0.26 | |||
smoothelin-like 2 | Smtnl2 | S339 | SQS*FGVASASSIK | NP_808444 | 0.06 | -0.34 | ||
synaptosomal-associated protein 23 | Snap23 | S110 | ATWGDGGDNS*PSNVVSK | NP_033248 | -0.09 | |||
Smad nuclear interacting protein 1 | Snip1 | S18 | HRS*GDALTTVVVK | NP_780455 | 0.24 | |||
Smad nuclear interacting protein 1 | Snip1 | S18 | S*GDALTTVVVK | NP_780455 | 0.66 | |||
U5 snRNP-specific protein, 200 kDa | Snrnp200 | S225 | EEAS*DDDMEGDEAVVR | NP_796188 | 0.14 | 0.06 | ||
U1 small nuclear ribonucleoprotein 70 kDa | Snrnp70 | S226 | YDERPGPS*PLPHR | NP_033250 | 0.08 | 0.14 | ||
U2 small nuclear ribonucleoprotein polypeptide A' | Snrpa1 | S178, T180 | RS*KT*FNPGAGLPTDKK | NP_067311 | ||||
syntrophin, basic 2 | Sntb2 | S75 | GLGPPS*PPAPPR | NP_033255 | -0.6 | |||
syntrophin, basic 2 | Sntb2 | S90 | GPAGEASAS*PPVR | NP_033255 | 0.2 | 0.21 | ||
syntrophin, basic 2 | Sntb2 | S90 | GPAGEASAS*PPVRR | NP_033255 | -0.23 | -0.08 | ||
SKI interacting protein | Snw1 | S224, S232 | GPPS*PPAPVMHS*PSR | NP_079783 | -0.15 | 0.26 | 0.26 | |
SKI interacting protein | Snw1 | S224, S232 | GPPS*PPAPVMHS*PSRK | NP_079783 | -0.03 | |||
SKI interacting protein | Snw1 | S224, S234 | GPPS*PPAPVMHSPS*R | NP_079783 | -0.14 | 0.07 | ||
SKI interacting protein | Snw1 | S224, S234 | GPPS*PPAPVMHSPS*RK | NP_079783 | 0.3 | |||
sorting nexin 1 | Snx1 | S187 | RFS*DFLGLYEK | NP_062701 | 5.33 | |||
sorting nexin 12 isoform 1 | Snx12 | S73 | RYS*DFEWLK | NP_001103780 | -0.09 | |||
sorting nexin 16 isoform b | Snx16 | S37, T38, S39, S40 | NQRSSSFGSVSTSS*T*S*S*K | NP_001120663 | ||||
sorting nexin 2 | Snx2 | T341 | ELSANT*AAFAK | NP_080662 | ||||
sorting nexin 2 | Snx2 | S185 | RFS*DFLGLHSK | NP_080662 | -0.04 | |||
sorting nexin 3 | Snx3 | S72 | RYS*DFEWLR | NP_059500 | 1.65 | 0.54 | ||
Son cell proliferation protein truncated isoform | Son | S1723 | ESAQAVAVALS*PK | NP_064357 | 0.05 | 0.12 | -0.21 | |
Son cell proliferation protein | Son | S2147 | EDDDVIVNKPHVS*DEEEEEPPFYHHPFK | NP_849211 | 0.23 | |||
sorbin and SH3 domain containing 1 isoform 3 | Sorbs1 | T81, S85 | ASSSYRGT*PSSS*PVSPQESPK | NP_001030134 | -1.73 | |||
sorbin and SH3 domain containing 1 isoform 3 | Sorbs1 | S629, S633 | S*ATVS*PQQPQAQQR | NP_001030134 | -0.71 | |||
sorbin and SH3 domain containing 1 isoform 3 | Sorbs1 | S633 | SATVS*PQQPQAQQR | NP_001030134 | -0.65 | |||
sorbin and SH3 domain containing 2 | Sorbs2 | S350 | PSAPDLS*PTR | NP_766340 | 0.41 | |||
sorbin and SH3 domain containing 2 | Sorbs2 | S431 | RKS*EPAVGPLR | NP_766340 | 1.09 | |||
sorbin and SH3 domain containing 2 | Sorbs2 | S27 | RVQS*SPNLLAAGR | NP_766340 | 0.01 | |||
sorbin and SH3 domain containing 2 | Sorbs2 | S470, S473 | SFISS*SPS*SPSR | NP_766340 | 0.07 | |||
sorbin and SH3 domain containing 2 | Sorbs2 | S470, S474 | SFISS*SPSS*PSR | NP_766340 | -0.21 | -0.34 | ||
sorbin and SH3 domain containing 2 | Sorbs2 | S471, S474 | SFISSS*PSS*PSR | NP_766340 | -0.36 | |||
sorbin and SH3 domain containing 2 | Sorbs2 | S473, S474 | SFISSSPS*S*PSR | NP_766340 | -0.36 | |||
sorbin and SH3 domain containing 2 | Sorbs2 | S473 | SFISSSPS*SPSR | NP_766340 | -1.6 | |||
sorbin and SH3 domain containing 2 | Sorbs2 | S474 | SFISSSPSS*PSR | NP_766340 | -0.79 | -0.39 | -0.08 | |
sorbin and SH3 domain containing 2 | Sorbs2 | S450 | TS*PGRADLPGSSSTFTK | NP_766340 | ||||
sorbin and SH3 domain containing 2 | Sorbs2 | S27 | VQS*SPNLLAAGR | NP_766340 | 0.06 | 0 | -0.05 | |
sorbin and SH3 domain containing 3 | Sorbs3 | S594 | LCDDGPQLPAS*PNPTTTAHLSSHSHPSSIPVDPTDWGGR | NP_035496 | -1.99 | |||
sorbin and SH3 domain containing 3 | Sorbs3 | S669 | PINLGPSS*PNTEIHWTPYR | NP_035496 | -1.11 | |||
sortilin 1 | Sort1 | S819 | SGYHDDS*DEDLLE | NP_064356 | ||||
SP140 nuclear body protein family member | Sp140 | T459 | EMT*VSVQEPMWLDIIK | NP_001013839 | ||||
sperm associated antigen 1 | Spag1 | S739, S740 | IQVQEVDGS*S*DEEPERPAEASATSAPAR | NP_036161 | -0.18 | |||
sperm associated antigen 5 | Spag5 | S23, T24 | GKPAMS*T*PLR | NP_059103 | ||||
speedy B | Spdyb | S130 | RVS*TVRPEHHK | NP_083324 | ||||
SPEN homolog, transcriptional regulator | Spen | S1683 | AEEAAEAPS*PAGEKPAEPAPVSEETK | NP_062737 | 0.28 | |||
sphingosine kinase 1 isoform 1 | Sphk1 | S231 | RPAS*TLVQK | NP_035581 | -0.26 | |||
spectrin alpha 2 | Spna2 | S1197 | WRS*LQQLAEER | NP_001070022 | -0.2 | |||
spectrin beta 2 isoform 2 | Spnb2 | S2124 | GDQVSQNGLPAEQGS*PR | NP_033286 | -0.03 | |||
spectrin beta 2 isoform 2 | Spnb2 | S2089 | RPPS*PDPNTK | NP_033286 | 0.14 | |||
spectrin beta 2 isoform 1 | Spnb2 | S2163, S2168 | ES*SPVPS*PTLDR | NP_787030 | 0.91 | |||
spectrin beta 2 isoform 1 | Spnb2 | S2164, S2168 | ESS*PVPS*PTLDR | NP_787030 | 0.92 | |||
spectrin beta 2 isoform 1 | Spnb2 | S2357 | RFS*LFGK | NP_787030 | ||||
spectrin beta 2 isoform 1 | Spnb2 | T2186 | SALPAQSAAT*LPAR | NP_787030 | 4.96 | 0.5 | ||
spectrin beta 2 isoform 1 | Spnb2 | S2160, S2163, S2168 | TSS*KES*SPVPS*PTLDRK | NP_787030 | -0.25 | |||
spectrin beta 2 isoform 1 | Spnb2 | S2160, S2164, S2168 | TSS*KESS*PVPS*PTLDR | NP_787030 | -0.39 | |||
secreted phosphoprotein 1 | Spp1 | S290 | ISHELESSS*SEVN | NP_033289 | ||||
SPRY domain containing 4 | Spryd4 | S133 | WHS*MLANEKAPIK | NP_079992 | ||||
sequestosome 1 | Sqstm1 | S24 | RFS*FCFSPEPEAEAQAAAGPGPCER | NP_035148 | 0.51 | |||
sequestosome 1 | Sqstm1 | T269, T272 | SRLT*PTT*PESSSTGTEDK | NP_035148 | -0.04 | |||
sequestosome 1 | Sqstm1 | T269 | SRLT*PTTPESSSTGTEDK | NP_035148 | -7.32 | |||
Rous sarcoma oncogene isoform 2 | Src | S17 | S*LEPSENVHGAGGAFPASQTPSKPASADGHR | NP_001020566 | 0.38 | |||
Rous sarcoma oncogene isoform 2 | Src | S21 | SLEPS*ENVHGAGGAFPASQTPSKPASADGHR | NP_001020566 | 0.79 | |||
sterol regulatory element binding factor 2 | Srebf2 | S903 | VPKALEVTES*PLVK | NP_150087 | ||||
src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites | Srms | T378 | LT*CKVADFGLAR | NP_035611 | ||||
src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites | Srms | T378 | LT*CKVADFGLAR | NP_035611 | ||||
signal recognition particle 14 | Srp14 | S45 | KSS*VEGLEPAENK | NP_033299 | 5.54 | |||
signal recognition particle 72 | Srp72 | S620, S621 | AVS*S*PPTSPRPGSAATISSSASNIVPPR | NP_079967 | 0.12 | -0.57 | -0.44 | |
signal recognition particle 72 | Srp72 | S620, T624 | AVS*SPPT*SPRPGSAATISSSASNIVPPR | NP_079967 | 0.17 | -0.09 | ||
signal recognition particle 72 | Srp72 | S620, S625 | AVS*SPPTS*PRPGSAATISSSASNIVPPR | NP_079967 | -0.07 | 0.2 | ||
signal recognition particle 72 | Srp72 | S621, T624 | AVSS*PPT*SPRPGSAATISSSASNIVPPR | NP_079967 | 0.31 | 0.05 | -0.39 | |
signal recognition particle 72 | Srp72 | S621, S625 | AVSS*PPTS*PRPGSAATISSSASNIVPPR | NP_079967 | 0.28 | -0.39 | ||
signal recognition particle 72 | Srp72 | T624, S625 | AVSSPPT*S*PRPGSAATISSSASNIVPPR | NP_079967 | ||||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S751, S753 | AAS*PS*PQSVR | NP_001123949 | -0.89 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S751 | AAS*PSPQSVR | NP_001123949 | -0.98 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S260 | APKPEPVPEPKEPS*PEK | NP_001123949 | -0.23 | -0.2 | ||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S265 | APKPEPVPEPKEPSPEKNS*K | NP_001123949 | -0.21 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | T707, S709 | APQT*SS*PPPVR | NP_001123949 | 0.11 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S708 | APQTS*SPPPVR | NP_001123949 | 0.08 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S709 | APQTSS*PPPVR | NP_001123949 | 0 | 0.1 | 0.06 | |
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S709 | APQTSS*PPPVRR | NP_001123949 | 0.1 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S220 | EKS*PELPEPSVR | NP_001123949 | 0.05 | 0.14 | -0.06 | |
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S395, T399 | HRPS*SPAT*PPPK | NP_001123949 | -0.04 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S396, T399 | HRPSS*PAT*PPPK | NP_001123949 | -0.03 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S220 | KEKS*PELPEPSVR | NP_001123949 | -0.26 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | T885 | KET*ESEAEDDNLDDLER | NP_001123949 | 0.14 | -0.28 | ||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S887 | KETES*EAEDDNLDDLER | NP_001123949 | 0.11 | -0.26 | ||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S782, S788, S790 | KPPAPPS*PVQSQS*PS*TNWSPAVPAK | NP_001123949 | -0.85 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S782, S788, T791 | KPPAPPS*PVQSQS*PST*NWSPAVPAK | NP_001123949 | -0.85 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S782, S788, S794 | KPPAPPS*PVQSQS*PSTNWS*PAVPAK | NP_001123949 | -0.06 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S782, S788 | KPPAPPS*PVQSQS*PSTNWSPAVPAK | NP_001123949 | -0.25 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S782, S790 | KPPAPPS*PVQSQSPS*TNWSPAVPAK | NP_001123949 | -0.22 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S782, T791 | KPPAPPS*PVQSQSPST*NWSPAVPAKK | NP_001123949 | -0.56 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S782, S794 | KPPAPPS*PVQSQSPSTNWS*PAVPAK | NP_001123949 | -0.24 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S786, S794 | KPPAPPSPVQS*QSPSTNWS*PAVPAK | NP_001123949 | -0.22 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S456 | KVELS*ESEEDKGSK | NP_001123949 | -0.09 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S458 | KVELSES*EEDKGSK | NP_001123949 | -0.11 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S726 | QS*PSPSTRPIR | NP_001123949 | ||||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S443 | RES*PSPAPKPR | NP_001123949 | -0.11 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S382, S384 | RLS*PS*ASPPR | NP_001123949 | -0.32 | 0.02 | ||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S382, S386 | RLS*PSAS*PPR | NP_001123949 | 0.05 | -0.69 | 0.02 | |
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S567, S569 | RRS*PS*PAPPPPPPPPPPR | NP_001123949 | 0.13 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | T628, S630 | RRT*AS*PPPPPK | NP_001123949 | 0.4 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | T628, S630 | RRT*AS*PPPPPKR | NP_001123949 | 0.17 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S567, S569 | RS*PS*PAPPPPPPPPPPR | NP_001123949 | -0.01 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S545 | RWQS*PVTK | NP_001123949 | 0.11 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | Y610 | RY*SPPIQR | NP_001123949 | 2.06 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S611 | RYS*PPIQR | NP_001123949 | -0.06 | 0.17 | 0.12 | |
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S619, S621 | RYS*PS*PPPK | NP_001123949 | -0.13 | 0.1 | -0.07 | |
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S567, S569 | S*PS*PAPPPPPPPPPPR | NP_001123949 | 0.3 | -0.22 | -0.03 | |
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | T588, S597 | SPT*PPPRRRTPS*PPPR | NP_001123949 | ||||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | T628, S630 | T*AS*PPPPPK | NP_001123949 | -0.13 | |||
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S630 | TAS*PPPPPK | NP_001123949 | -0.04 | -0.09 | -0.2 | |
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S630 | TAS*PPPPPKR | NP_001123949 | 0.67 | 0.38 | -0.05 | |
serine/arginine repetitive matrix 1 isoform 2 | Srrm1 | S545 | WQS*PVTK | NP_001123949 | 0.01 | -0.14 | -0.07 | |
serine/arginine repetitive matrix 2 | Srrm2 | S1168 | AAETPAVASCWS*GPQVSPEHK | NP_780438 | -0.12 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S1173 | AAETPAVASCWSGPQVS*PEHK | NP_780438 | -0.78 | -0.14 | ||
serine/arginine repetitive matrix 2 | Srrm2 | S300 | AAIPSSQEPVNPSSEAS*PTR | NP_780438 | 0.17 | |||
serine/arginine repetitive matrix 2 | Srrm2 | T302 | AAIPSSQEPVNPSSEASPT*R | NP_780438 | 0.33 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S2264, T2266 | ARS*RT*PPSAPSQSR | NP_780438 | 0.95 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S1988 | CRS*PGMLEPLGSAR | NP_780438 | ||||
serine/arginine repetitive matrix 2 | Srrm2 | S1988 | CRS*PGMLEPLGSAR | NP_780438 | 0.09 | -0.44 | ||
serine/arginine repetitive matrix 2 | Srrm2 | T1294 | DGLPRT*PSR | NP_780438 | -0.28 | |||
serine/arginine repetitive matrix 2 | Srrm2 | T1294 | DGLPRT*PSRR | NP_780438 | 0.22 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S1055 | DKFS*PTQDRPESSTVLK | NP_780438 | -0.34 | -0.13 | -0.19 | |
serine/arginine repetitive matrix 2 | Srrm2 | S1180 | ELS*HSPPRENSFESSLEFK | NP_780438 | 0.56 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S1182 | ELSHS*PPR | NP_780438 | -0.06 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S1182 | ELSHS*PPRENSFESSLEFK | NP_780438 | -0.1 | |||
serine/arginine repetitive matrix 2 | Srrm2 | T940 | GHTQTWPDT*SSPEVMQTQVESPLLQSK | NP_780438 | ||||
serine/arginine repetitive matrix 2 | Srrm2 | S942 | GHTQTWPDTSS*PEVMQTQVESPLLQSK | NP_780438 | 0.03 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S966, S968 | GS*LS*RSSSPVTELTARSPVK | NP_780438 | ||||
serine/arginine repetitive matrix 2 | Srrm2 | T867 | HSGST*SPYLK | NP_780438 | -0.51 | -0.02 | ||
serine/arginine repetitive matrix 2 | Srrm2 | S868 | HSGSTS*PYLK | NP_780438 | -0.18 | -0.02 | ||
serine/arginine repetitive matrix 2 | Srrm2 | Y870 | HSGSTSPY*LK | NP_780438 | 0.06 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S1322 | HSLSGS*SPGMK | NP_780438 | -1.76 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S1323 | HSLSGSS*PGMK | NP_780438 | -0.96 | |||
serine/arginine repetitive matrix 2 | Srrm2 | T859 | MELGT*PLR | NP_780438 | -0.06 | 0.6 | -0.22 | |
serine/arginine repetitive matrix 2 | Srrm2 | S1977, S1979 | MSCFSRPS*MS*PTPLDR | NP_780438 | -0.2 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S2308 | MVQASSQSLLPPAQDRPRS*PVPSAFSDQSR | NP_780438 | 0.79 | -0.46 | ||
serine/arginine repetitive matrix 2 | Srrm2 | S1956, S1958 | NHS*GS*RTPPVALSSSR | NP_780438 | 0.01 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S1956, T1960 | NHS*GSRT*PPVALSSSR | NP_780438 | 0.1 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S365 | NRS*HGRAKR | NP_780438 | ||||
serine/arginine repetitive matrix 2 | Srrm2 | S1209 | NSGPVSEVNTGFS*PEVK | NP_780438 | -0.09 | -0.1 | 0.1 | |
serine/arginine repetitive matrix 2 | Srrm2 | S300 | PLAAIPSSQEPVNPSSEAS*PTR | NP_780438 | -0.02 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S1979 | PSMS*PTPLDR | NP_780438 | -1.73 | 0.34 | 0.71 | |
serine/arginine repetitive matrix 2 | Srrm2 | S2560, S2564 | RQPS*PQPS*PR | NP_780438 | 0.32 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S2560 | RQPS*PQPSPR | NP_780438 | -0.02 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S1589, S1599 | RRSPS*VSSPEPTEKS*R | NP_780438 | ||||
serine/arginine repetitive matrix 2 | Srrm2 | S1242, S1243, S1247 | RS*S*SELS*PEVVEK | NP_780438 | -0.05 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S1242, S1247 | RS*SSELS*PEVVEK | NP_780438 | ||||
serine/arginine repetitive matrix 2 | Srrm2 | S1243, S1247 | RSS*SELS*PEVVEK | NP_780438 | 0.61 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S1243 | RSS*SELSPEVVEK | NP_780438 | 0.92 | 1.08 | 0.46 | * |
serine/arginine repetitive matrix 2 | Srrm2 | S1244 | RSSS*ELSPEVVEK | NP_780438 | ||||
serine/arginine repetitive matrix 2 | Srrm2 | S2439 | RVPS*PTPVPK | NP_780438 | -0.13 | 0.08 | 0.24 | |
serine/arginine repetitive matrix 2 | Srrm2 | T2441 | RVPSPT*PVPK | NP_780438 | -0.14 | 0.29 | 0.57 | |
serine/arginine repetitive matrix 2 | Srrm2 | S1399 | S*GSSQELDGKPSASPQER | NP_780438 | ||||
serine/arginine repetitive matrix 2 | Srrm2 | S725, S733, T745 | S*GTPPRPGS*VTNMQADECTAT*PQR | NP_780438 | -0.01 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S725, S733 | S*GTPPRPGS*VTNMQADECTATPQR | NP_780438 | 1.59 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S725, T745 | S*GTPPRPGSVTNMQADECTAT*PQR | NP_780438 | 0.06 | -0.36 | ||
serine/arginine repetitive matrix 2 | Srrm2 | S725 | S*GTPPRPGSVTNMQADECTATPQR | NP_780438 | 0.24 | -0.4 | -0.44 | |
serine/arginine repetitive matrix 2 | Srrm2 | S1923, T1925, S1927 | S*LT*RS*PPAIR | NP_780438 | 0.12 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S1988 | S*PGMLEPLGSAR | NP_780438 | -0.1 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S2308 | S*PVPSAFSDQSR | NP_780438 | -0.23 | 0.17 | 0.01 | |
serine/arginine repetitive matrix 2 | Srrm2 | S1900, S1902 | S*RS*PLAIR | NP_780438 | ||||
serine/arginine repetitive matrix 2 | Srrm2 | S1738, T1740 | S*RT*PLISR | NP_780438 | ||||
serine/arginine repetitive matrix 2 | Srrm2 | S1888, T1890 | S*RT*PLLPR | NP_780438 | 0.63 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S1876, T1878 | S*RT*PPAIR | NP_780438 | 0.39 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S2264, T2266 | S*RT*PPSAPSQSR | NP_780438 | 0.04 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S2264 | S*RTPPSAPSQSR | NP_780438 | 0.15 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S970 | S*SSPVTELTAR | NP_780438 | -0.09 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S253, S255 | SAVRPS*PS*PER | NP_780438 | -0.16 | -0.09 | ||
serine/arginine repetitive matrix 2 | Srrm2 | S253 | SAVRPS*PSPER | NP_780438 | 0.54 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S255 | SAVRPSPS*PER | NP_780438 | 0.18 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S1118 | SEQPLSQVLPS*LSPEHK | NP_780438 | 0.13 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S1120 | SEQPLSQVLPSLS*PEHK | NP_780438 | 0.89 | 0.22 | 0.12 | |
serine/arginine repetitive matrix 2 | Srrm2 | S1401 | SGS*SQELDGKPSASPQER | NP_780438 | 1 | |||
serine/arginine repetitive matrix 2 | Srrm2 | T727, S733, T745 | SGT*PPRPGS*VTNMQADECTAT*PQR | NP_780438 | -0.36 | |||
serine/arginine repetitive matrix 2 | Srrm2 | T727, T745 | SGT*PPRPGSVTNMQADECTAT*PQR | NP_780438 | 0.15 | -0.45 | -0.34 | |
serine/arginine repetitive matrix 2 | Srrm2 | T727 | SGT*PPRPGSVTNMQADECTATPQR | NP_780438 | 0.23 | -0.36 | -0.43 | |
serine/arginine repetitive matrix 2 | Srrm2 | S733 | SGTPPRPGS*VTNMQADECTATPQR | NP_780438 | -0.55 | |||
serine/arginine repetitive matrix 2 | Srrm2 | T735, T745 | SGTPPRPGSVT*NMQADECTAT*PQR | NP_780438 | ||||
serine/arginine repetitive matrix 2 | Srrm2 | S679, S682 | SLS*GSS*PCPK | NP_780438 | -0.98 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S2550, S2552 | SLS*YS*PVER | NP_780438 | 0.2 | 0.02 | ||
serine/arginine repetitive matrix 2 | Srrm2 | T877, S886 | SMLQT*PPDQNLSGS*KSPCPQK | NP_780438 | 0.17 | |||
serine/arginine repetitive matrix 2 | Srrm2 | T877 | SMLQT*PPDQNLSGSK | NP_780438 | -0.11 | |||
serine/arginine repetitive matrix 2 | Srrm2 | T877, S888 | SMLQT*PPDQNLSGSKS*PCPQK | NP_780438 | 0.2 | 0.29 | ||
serine/arginine repetitive matrix 2 | Srrm2 | S886 | SMLQTPPDQNLSGS*KSPCPQK | NP_780438 | -0.67 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S888 | SMLQTPPDQNLSGSKS*PCPQK | NP_780438 | -0.17 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S1977, S1979 | SRPS*MS*PTPLDR | NP_780438 | 0.02 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S1977, T1981 | SRPS*MSPT*PLDR | NP_780438 | 0.02 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S1979 | SRPSMS*PTPLDR | NP_780438 | 0.14 | |||
serine/arginine repetitive matrix 2 | Srrm2 | T2266 | SRT*PPSAPSQSR | NP_780438 | ||||
serine/arginine repetitive matrix 2 | Srrm2 | T2266 | SRT*PPSAPSQSR | NP_780438 | -0.01 | 0.32 | 0.12 | |
serine/arginine repetitive matrix 2 | Srrm2 | S1717 | SRTS*PAPWK | NP_780438 | 0.75 | 0.02 | ||
serine/arginine repetitive matrix 2 | Srrm2 | S971 | SS*SPVTELTAR | NP_780438 | 0.17 | -0.12 | ||
serine/arginine repetitive matrix 2 | Srrm2 | S972 | SSS*PVTELTAR | NP_780438 | -0.31 | 0.34 | -0.06 | |
serine/arginine repetitive matrix 2 | Srrm2 | T1960 | T*PPVALSSSR | NP_780438 | 0.03 | |||
serine/arginine repetitive matrix 2 | Srrm2 | T2254 | T*SPLMLDR | NP_780438 | 0.11 | -0.23 | ||
serine/arginine repetitive matrix 2 | Srrm2 | S2128 | TPAAAAAMNLAS*PR | NP_780438 | -1.46 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S2255 | TS*PLMLDR | NP_780438 | 0.13 | 0.11 | -0.01 | |
serine/arginine repetitive matrix 2 | Srrm2 | S2439 | VPS*PTPVPK | NP_780438 | 0.35 | |||
serine/arginine repetitive matrix 2 | Srrm2 | S1263 | VS*SPVLETVQQR | NP_780438 | 0 | -0.03 | 0.03 | |
serine/arginine repetitive matrix 2 | Srrm2 | S1264 | VSS*PVLETVQQR | NP_780438 | 0.04 | 0.11 | 0.01 | |
arsenate resistance protein 2 isoform 2 | Srrt | S67 | ERFS*PPR | NP_001103379 | -0.17 | |||
arsenate resistance protein 2 isoform 2 | Srrt | S74 | HELS*PPQK | NP_001103379 | -0.24 | 0.19 | ||
arsenate resistance protein 2 isoform 2 | Srrt | S539 | TQLWAS*EPGTPPVPTSLPSQNPILK | NP_001103379 | -0.45 | |||
arsenate resistance protein 2 isoform 2 | Srrt | T543 | TQLWASEPGT*PPVPTSLPSQNPILK | NP_001103379 | 0.03 | 7.72 | ||
sperm specific antigen 2 | Ssfa2 | S898, S903 | ACS*VNPPS*AIEMQLR | NP_542125 | ||||
slingshot homolog 3 | Ssh3 | S38 | RQS*FAVLR | NP_932781 | 0.23 | -0.01 | ||
slingshot homolog 3 | Ssh3 | S9 | S*PPASGHSTPVGPTQDR | NP_932781 | 0.12 | |||
signal sequence receptor, alpha | Ssr1 | S268 | VEMGTSSQNDVDMSWIPQETLNQINKAS*PR | NP_080241 | 1.22 | |||
structure specific recognition protein 1 isoform 2 | Ssrp1 | S444 | EGINPGYDDYADS*DEDQHDAYLER | NP_001129553 | 0.16 | 0.21 | -0.04 | |
C184L-22 | Sssca1 | S35 | QDRIS*RLMGDYLLR | NP_065237 | ||||
matriptase | St14 | S13 | AGGGS*QDFGAGLK | NP_035306 | 6.12 | |||
stromal antigen 3 | Stag3 | S408 | MVS*MVMDR | NP_058660 | ||||
START domain containing 10 | Stard10 | S284 | AGGAGGEGS*DDDTSLT | NP_064374 | ||||
StAR-related lipid transfer (START) domain containing 13 isoform 1 | Stard13 | S632 | LTAIMEKYS*MSNK | NP_001156965 | ||||
STEAP family member 4 | Steap4 | T274 | RGT*KYRR | NP_473439 | ||||
stromal interaction molecule 1 | Stim1 | S575 | LPDS*PALAK | NP_033313 | -0.09 | |||
stromal interaction molecule 2 | Stim2 | S793 | VSS*IPHDLCHNGEK | NP_001074572 | 0.05 | |||
serine/threonine kinase 10 | Stk10 | T950 | LSEEAEPRPTT*PSK | NP_033314 | -0.19 | |||
serine/threonine kinase 10 | Stk10 | S191 | RDS*FIGTPY | NP_033314 | 0.6 | |||
serine/threonine kinase 11 | Stk11 | S31 | IDS*TEVIYQPR | NP_035622 | 0.21 | |||
serine/threonine kinase 11 | Stk11 | T32 | IDST*EVIYQPR | NP_035622 | 0.31 | |||
serine/threonine kinase 11 | Stk11 | S424 | VCSS*NKIRR | NP_035622 | ||||
serine/threonine kinase 3 | Stk3 | S316 | ELEEEEENS*DEDELDSHTMVK | NP_062609 | -0.12 | |||
stathmin 1 | Stmn1 | S16 | AS*GQAFELILSPR | NP_062615 | -0.3 | |||
stathmin 1 | Stmn1 | S25 | ASGQAFELILS*PR | NP_062615 | -2.01 | |||
stathmin 1 | Stmn1 | S38 | ESVPDFPLS*PPK | NP_062615 | -0.12 | -0.18 | 0.25 | |
stathmin 1 | Stmn1 | S16 | RAS*GQAFELILSPR | NP_062615 | 1.02 | 0.55 | ||
stathmin 1 | Stmn1 | S38 | SKESVPDFPLS*PPK | NP_062615 | 0.21 | |||
storkhead box 1 | Stox1 | Y804, S811, S816, S829 | NPWY*KATGLFS*NAGES*PNPDLSDNPGQNS*R | NP_001028432 | ||||
storkhead box 1 | Stox1 | T807, S811, S816, S829 | NPWYKAT*GLFS*NAGES*PNPDLSDNPGQNS*R | NP_001028432 | ||||
striatin, calmodulin binding protein | Strn | S245 | FLESAAADVS*DEDEDEDTDGR | NP_035630 | 0.37 | |||
striatin, calmodulin binding protein 3 | Strn3 | S229 | NLEQILNGGES*PK | NP_443205 | -0.11 | |||
STIP1 homology and U-box containing protein 1 | Stub1 | T15 | LGT*GGGGSPDKSPSAQELK | NP_062693 | 0.09 | -0.3 | -0.01 | |
STIP1 homology and U-box containing protein 1 | Stub1 | S20 | LGTGGGGS*PDKSPSAQELK | NP_062693 | 0.47 | -0.3 | -0.05 | |
syntaxin 4A (placental) | Stx4a | S15 | QGDNIS*DDEDEVR | NP_033320 | -0.2 | |||
syntaxin 7 | Stx7 | S126, S137 | VRASS*RVSGGFPEDSS*K | NP_058077 | ||||
syntaxin binding protein 5 (tomosyn) | Stxbp5 | S724 | KLS*LPTDLKPDLDVK | NP_001074813 | 1.54 | |||
syntaxin binding protein 5 (tomosyn) | Stxbp5 | S747, S750 | SSS*VTS*IDKESR | NP_001074813 | 0.45 | |||
RIKEN cDNA 2400003N08 isoform b | Suds3 | T49 | ESDEDT*EDASETDLAK | NP_001116138 | 0.26 | |||
RIKEN cDNA 2400003N08 isoform b | Suds3 | S234, S237 | RPAS*PSS*PEHLPATPAESPAQR | NP_001116138 | 0.2 | |||
suppressor of fused homolog isoform 2 | Sufu | S301 | RLS*GKDTEQIR | NP_001020562 | 1.54 | |||
sulfotransferase family, cytosolic, 1C, member 1 | Sult1c1 | S296, T297, T299 | MAGS*T*IT*FR | NP_061221 | ||||
sulfotransferase family, cytosolic, 1C, member 2 | Sult1c2 | T261 | KGT*VGDWK | NP_081211 | -0.58 | |||
sulfotransferase family 1D, member 1 | Sult1d1 | S261 | KGIS*GDWK | NP_058051 | -0.6 | |||
suppressor of Ty 3 homolog | Supt3h | S274, S275 | S*S*PDSPENTPPPTPTAPSSGSQHSGR | NP_848767 | -0.22 | |||
suppressor of Ty 3 homolog | Supt3h | S278, T282 | SSPDS*PENT*PPPTPTAPSSGSQHSGR | NP_848767 | -0.27 | |||
suppressor of Ty 3 homolog | Supt3h | T282, T286 | SSPDSPENT*PPPT*PTAPSSGSQHSGR | NP_848767 | ||||
suppressor of Ty 5 homolog | Supt5h | S664 | DVTNLTVGGFTPMS*PR | NP_038704 | -0.05 | |||
supervillin isoform 1 | Svil | S857 | KLS*VDNNTSATDYK | NP_694793 | 1.24 | |||
synapse associated protein 1 | Syap1 | T262 | SSNRDDNLPLTEAVRPKT*PPVVIK | NP_080208 | -0.72 | |||
synapse associated protein 1 | Syap1 | T262 | T*PPVVIK | NP_080208 | -0.65 | |||
synaptic nuclear envelope 2 | Syne2 | S6348 | EAS*ENETDIEDPR | NP_001005510 | 0.2 | |||
synaptic nuclear envelope 2 | Syne2 | S4111 | EEAEESS*VKSEDGR | NP_001005510 | -0.29 | |||
synaptic nuclear envelope 2 | Syne2 | S4114 | EEAEESSVKS*EDGR | NP_001005510 | -0.22 | -0.84 | ||
synaptic nuclear envelope 2 | Syne2 | S162, T164 | LAQTLSCDYNQPSPEVVSVAASS*PT*SSPPTK | NP_001005510 | -0.71 | |||
synaptic nuclear envelope 2 | Syne2 | T4190 | LSQT*DEGATPPIEAALLDFPR | NP_001005510 | 1.26 | |||
synaptic nuclear envelope 2 | Syne2 | T4195 | LSQTDEGAT*PPIEAALLDFPR | NP_001005510 | 0.32 | |||
synaptic nuclear envelope 2 | Syne2 | T6335 | LT*SHTPGLDDEKEASENETDIEDPR | NP_001005510 | 6.61 | |||
synaptic nuclear envelope 2 | Syne2 | S6348 | LTSHTPGLDDEKEAS*ENETDIEDPR | NP_001005510 | 0.35 | -0.38 | -0.08 | |
synaptic nuclear envelope 2 | Syne2 | T6352 | LTSHTPGLDDEKEASENET*DIEDPR | NP_001005510 | 0.18 | |||
synaptic nuclear envelope 2 | Syne2 | S6371 | RES*EEPTSPQSLCHLVPPALGHER | NP_001005510 | 1.86 | 3.16 | ||
synaptic nuclear envelope 2 | Syne2 | S6371 | RRES*EEPTSPQSLCHLVPPALGHER | NP_001005510 | 2.14 | 3.52 | ||
synaptic nuclear envelope 2 | Syne2 | S6448 | SISEGHPWHVPDS*PSHSK | NP_001005510 | -0.99 | |||
synaptic nuclear envelope 2 | Syne2 | T4094 | T*NSMSFLPVVK | NP_001005510 | -0.07 | -1.26 | ||
synaptic nuclear envelope 2 | Syne2 | S4096 | TNS*MSFLPVVK | NP_001005510 | 0.19 | -0.07 | -0.28 | |
synaptopodin isoform B | Synpo | S433 | DRAS*PAAAEEAVPEWASCLK | NP_001103445 | 0.04 | |||
synaptopodin isoform A | Synpo | S819 | GAAFS*PIPR | NP_796314 | -2.44 | -2.25 | ||
synaptopodin isoform A | Synpo | S803 | MRS*PQPASPAR | NP_796314 | -0.45 | |||
synaptopodin isoform A | Synpo | S892 | RGS*LPTEASCTT | NP_796314 | 1.95 | |||
synaptotagmin XIV | Syt14 | T9 | T*CGVHELICIR | NP_853524 | -5.23 | |||
transforming, acidic coiled-coil containing protein 2 isoform c | Tacc2 | S2213, S2217 | LDNTPAS*PPRS*PTEPSDTPIAK | NP_001004468 | 0.1 | |||
transforming, acidic coiled-coil containing protein 2 isoform c | Tacc2 | S2122 | VQNS*PPVGR | NP_001004468 | -0.75 | |||
TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor | Taf6 | S673 | ANGSQPTGPGS*PQPAL | NP_033341 | ||||
TBC1 domain family, member 1 | Tbc1d1 | T590 | ANT*LSHFPVECPAPPEPAQSSPGVSQR | NP_062610 | 1.33 | |||
TBC1 domain family, member 1 | Tbc1d1 | S607 | ANTLSHFPVECPAPPEPAQS*SPGVSQR | NP_062610 | -4.59 | |||
TBC1 domain family, member 1 | Tbc1d1 | S608 | ANTLSHFPVECPAPPEPAQSS*PGVSQR | NP_062610 | -4.59 | |||
TBC1 domain family, member 1 | Tbc1d1 | S1148 | PS*TPEPDCTQLEPTGD | NP_062610 | ||||
TBC1 domain family, member 1 | Tbc1d1 | S231 | SFS*QPGLR | NP_062610 | 0.05 | 0.13 | -0.24 | |
TBC1 domain family, member 1 | Tbc1d1 | S255 | SSTFS*SFDNDIENHLIGGHNVVQPTDMEENR | NP_062610 | -0.45 | |||
TBC1 domain family, member 1 | Tbc1d1 | S621 | YHS*VSTETPHER | NP_062610 | -0.23 | |||
TBC1 domain family, member 1 | Tbc1d1 | S623 | YHSVS*TETPHER | NP_062610 | -0.12 | |||
TBC1 domain family, member 1 | Tbc1d1 | T624 | YHSVST*ETPHER | NP_062610 | -0.31 | |||
TBC1 domain family, member 10a | Tbc1d10a | S407 | AILDAEPGPRPALQPS*PSIR | NP_598784 | -0.68 | |||
TBC1 domain family, member 10a | Tbc1d10a | S18 | ENGPREPAAGGS*LSGTR | NP_598784 | -2.57 | |||
TBC1 domain family, member 10a | Tbc1d10a | S18 | EPAAGGS*LSGTR | NP_598784 | -0.2 | |||
TBC1 domain family, member 14 isoform a | Tbc1d14 | S112 | RKQS*ESEIVPER | NP_001106833 | 4.75 | |||
TBC1 domain family, member 2 | Tbc1d2 | S914 | APPEGCVS*EDEGEGDS | NP_941066 | ||||
TBC1 domain family, member 23 | Tbc1d23 | S466, S469 | GS*ISS*VDGESCNGSNDR | NP_080530 | 5.61 | |||
TBC1 domain family, member 4 | Tbc1d4 | T649 | AHT*FSHPPSSSR | NP_001074747 | >10 | |||
TBC1 domain family, member 4 | Tbc1d4 | S348 | HAS*APSHVQPSDSEK | NP_001074747 | 0.26 | 0.02 | ||
TBC1 domain family, member 4 | Tbc1d4 | S348 | HAS*APSHVQPSDSEKNR | NP_001074747 | -0.18 | |||
TBC1 domain family, member 4 | Tbc1d4 | S351 | HASAPS*HVQPSDSEK | NP_001074747 | 0.02 | |||
TBC1 domain family, member 4 | Tbc1d4 | S595, S598 | LGS*MDS*FER | NP_001074747 | -0.07 | |||
TBC1 domain family, member 4 | Tbc1d4 | S595 | LGS*MDSFER | NP_001074747 | 0.58 | 0.38 | ||
TBC1 domain family, member 4 | Tbc1d4 | S598 | LGSMDS*FER | NP_001074747 | -1.33 | |||
TBC1 domain family, member 4 | Tbc1d4 | S573, T575, S577 | RS*LT*SS*LENIFSR | NP_001074747 | ||||
TBC1 domain family, member 4 | Tbc1d4 | S577 | SLTSS*LENIFSR | NP_001074747 | -1.45 | |||
transcription elongation factor A (SII) 1 isoform 3 | Tcea1 | S100 | EPAISSQNS*PEAR | NP_001153222 | 0.01 | 0.19 | 0.2 | |
transcription elongation factor A (SII) 1 isoform 3 | Tcea1 | S100 | KEPAISSQNS*PEAR | NP_001153222 | 0.27 | |||
transcription elongation factor A (SII) 1 isoform 3 | Tcea1 | S100 | KKEPAISSQNS*PEAR | NP_001153222 | 0.2 | 0.02 | ||
transcription factor 20 isoform a | Tcf20 | S587 | AGS*SPTQGAQNEAPR | NP_001107612 | -0.05 | 0.33 | 0.05 | |
transcription factor 20 isoform a | Tcf20 | S588 | AGSS*PTQGAQNEAPR | NP_001107612 | 0.02 | 0.04 | 0.07 | |
transcription factor 20 isoform a | Tcf20 | S669 | GSQEDDPAASQRPPS*NSGVK | NP_001107612 | 0.74 | |||
transcription factor 21 | Tcf21 | T104, T105, S116 | T*T*LPWVPPDTKLS*K | NP_035675 | ||||
transcription factor 3 isoform 1 | Tcf3 | S399, Y406, Y407 | KWHNLS*REEQAKY*Y*ELAR | NP_001073290 | -3.26 | |||
treacle | Tcof1 | S1216 | ASAVS*PEKAPMTSK | NP_035682 | 0.35 | -0.27 | -0.03 | |
treacle | Tcof1 | S1191 | KLS*GDLEAGAPK | NP_035682 | 1.52 | |||
treacle | Tcof1 | S169, T171 | SAEPLANTVLAS*ET*EEEGNAQALGPTAK | NP_035682 | -0.26 | |||
tektin 4 | Tekt4 | T432 | DIAVKTNSLFIDRQKCMT*HR | NP_082227 | -0.85 | |||
telomerase reverse transcriptase | Tert | S969 | LLS*VLRLK | NP_033380 | -8.08 | |||
testis-specific protein kinase 1 | Tesk1 | S342, S353 | GGPS*ATLPRPDPRLS*R | NP_035701 | ||||
testis-specific kinase 2 | Tesk2 | S301 | LRPS*FEEIGKTLKEIMSR | NP_666263 | ||||
tet oncogene 1 | Tet1 | S10, S12 | MSRSRPAKPS*KS*VK | NP_081660 | ||||
testis expressed gene 24 | Tex24 | S70, T71 | SLAELPS*T*AHGK | NP_001013627 | 0.33 | |||
tuftelin interacting protein 11 | Tfip11 | S60 | EEATYGVWAERDS*DEERPSFGGK | NP_061253 | 0 | |||
TCF3 (E2A) fusion partner | Tfpt | S245 | LLPYPTLAS*PPFD | NP_076013 | ||||
thyroglobulin | Tg | T2257 | FRAPEVLNWTGSWDAT*KPR | NP_033401 | ||||
trans-golgi network protein | Tgoln1 | S130 | SDQSS*TEDSGKPTGGNSGKPTGGDSGKPTEAGSNK | NP_033469 | -0.24 | |||
thyroid hormone receptor associated protein 3 | Thrap3 | S238, S243 | AS*VSDLS*PR | NP_666265 | -0.21 | |||
thyroid hormone receptor associated protein 3 | Thrap3 | S243 | ASVSDLS*PR | NP_666265 | -0.23 | 0.13 | 0.12 | |
thyroid hormone receptor associated protein 3 | Thrap3 | S248, S253 | ERS*PALKS*PLQSVVVR | NP_666265 | -0.24 | |||
thyroid hormone receptor associated protein 3 | Thrap3 | S248 | ERS*PALKSPLQSVVVR | NP_666265 | -0.11 | |||
thyroid hormone receptor associated protein 3 | Thrap3 | S379 | GGFS*DADVK | NP_666265 | 2.02 | -0.3 | ||
thyroid hormone receptor associated protein 3 | Thrap3 | S695 | HGLTHEELKS*PR | NP_666265 | 0.25 | |||
thyroid hormone receptor associated protein 3 | Thrap3 | S679 | IDIS*PSTFR | NP_666265 | -0.16 | 0.06 | 0 | |
thyroid hormone receptor associated protein 3 | Thrap3 | S681 | IDISPS*TFR | NP_666265 | ||||
thyroid hormone receptor associated protein 3 | Thrap3 | S572 | MDS*FDEDLAR | NP_666265 | -2.36 | |||
thyroid hormone receptor associated protein 3 | Thrap3 | S572 | MDS*FDEDLARPSGLLAQER | NP_666265 | 0.02 | |||
thyroid hormone receptor associated protein 3 | Thrap3 | S679 | RIDIS*PSTFR | NP_666265 | 0.34 | 0.17 | ||
thyroid hormone receptor associated protein 3 | Thrap3 | S681 | RIDISPS*TFR | NP_666265 | ||||
thyroid hormone receptor associated protein 3 | Thrap3 | S681 | RIDISPS*TFRK | NP_666265 | ||||
thyroid hormone receptor associated protein 3 | Thrap3 | S167, S171, S172 | RSSSSRSSSNHS*RVES*S*K | NP_666265 | ||||
thyroid hormone receptor associated protein 3 | Thrap3 | S320 | S*PPATGSAYGSSQK | NP_666265 | 0.1 | -0.06 | -0.03 | |
thyroid hormone receptor associated protein 3 | Thrap3 | S320 | S*PPATGSAYGSSQKEESAASGGAAYSK | NP_666265 | 0.74 | |||
thyroid hormone receptor associated protein 3 | Thrap3 | S315, S320 | S*PVGKS*PPATGSAYGSSQK | NP_666265 | 0.41 | -0.76 | ||
thyroid hormone receptor associated protein 3 | Thrap3 | S315, T324 | S*PVGKSPPAT*GSAYGSSQK | NP_666265 | -0.8 | |||
thyroid hormone receptor associated protein 3 | Thrap3 | Y869 | SREEEWDPEY*TPK | NP_666265 | 0.31 | |||
thyroid hormone receptor associated protein 3 | Thrap3 | T870 | SREEEWDPEYT*PK | NP_666265 | ||||
thyroid hormone receptor associated protein 3 | Thrap3 | S924, S935 | WAHDKFS*GEEGEIEDDES*GTENREEK | NP_666265 | 0.45 | |||
thrombospondin, type I, domain 1 | Thsd1 | T652, S654 | SSLFRRT*AS*FHETK | NP_062522 | 2.6 | |||
PREDICTED: thrombospondin, type I, domain containing 7A isoform 1 | Thsd7a | T1178 | VTFVDMRDNCGEGVQT*RK | XP_287555 | ||||
THUMP domain containing 1 | Thumpd1 | S86, S88 | FIDKDQQPS*GS*EGEDDDAEAALKK | NP_663560 | -0.16 | |||
Tial1 cytotoxic granule-associated RNA binding protein-like 1 | Tial1 | S154 | VVKDMATGKS*K | NP_033409 | ||||
T-cell lymphoma invasion and metastasis 1 isoform 1 | Tiam1 | S358 | SNATNSSYS*PPTGR | NP_001139358 | -0.13 | |||
T-cell lymphoma invasion and metastasis 2 | Tiam2 | S1512, S1513 | NRVPVSAKLAS*S*R | NP_001116470 | ||||
timeless homolog isoform 2 | Timeless | S957 | LAPSCMQNGEKS*PR | NP_035719 | -4.16 | |||
translocase of inner mitochondrial membrane 44 | Timm44 | S106, T114 | YKS*IESETVRT*SEAIK | NP_035722 | ||||
tight junction associated protein 1 | Tjap1 | S527 | KDS*LTQAQEQGTVLS | NP_083027 | 0.41 | |||
tight junction protein 1 isoform 2 | Tjp1 | S1534 | AVPVS*PSAVEEDEDEDGHTVVATAR | NP_001157046 | -0.56 | |||
tight junction protein 1 isoform 2 | Tjp1 | S320, S323, S326, S329, S337 | S*EPS*DHS*TQS*PQQPSNGS*LRSR | NP_001157046 | ||||
tight junction protein 1 isoform 2 | Tjp1 | S617 | S*REDLSAQPVQTK | NP_001157046 | 0.23 | 0.05 | 0.05 | |
tight junction protein 1 isoform 2 | Tjp1 | S323 | SEPS*DHSTQSPQQPSNGSLR | NP_001157046 | 0.09 | |||
tight junction protein 1 isoform 2 | Tjp1 | S125, S131 | VQIPVSHPDPEPVS*DNEDDS*YDEEVHDPR | NP_001157046 | -0.24 | |||
tight junction protein 1 isoform 2 | Tjp1 | S125, Y132 | VQIPVSHPDPEPVS*DNEDDSY*DEEVHDPR | NP_001157046 | -0.24 | |||
tight junction protein 1 isoform 2 | Tjp1 | S125 | VQIPVSHPDPEPVS*DNEDDSYDEEVHDPR | NP_001157046 | -0.7 | |||
tight junction protein 1 isoform 2 | Tjp1 | S131 | VQIPVSHPDPEPVSDNEDDS*YDEEVHDPR | NP_001157046 | 0.38 | |||
tight junction protein 1 isoform 1 | Tjp1 | S912 | IDS*PGLKPASQQK | NP_033412 | -1.57 | -1.53 | -1.17 | * |
tight junction protein 2 | Tjp2 | S968 | DAS*PPPAFKPEPPK | NP_035727 | 0.4 | -0.21 | -0.16 | |
tight junction protein 2 | Tjp2 | S1133 | GS*YGSDPEEEEYRQQLAAHSK | NP_035727 | ||||
tight junction protein 2 | Tjp2 | Y1134 | GSY*GSDPEEEEYR | NP_035727 | -27.4 | |||
tight junction protein 2 | Tjp2 | S1136 | GSYGS*DPEEEEYR | NP_035727 | 0.09 | -0.17 | ||
tight junction protein 2 | Tjp2 | S1136 | GSYGS*DPEEEEYRQQLAAHSK | NP_035727 | -0.37 | |||
tight junction protein 2 | Tjp2 | S107, S111 | KVQVAPLQGS*PPLS*HDDR | NP_035727 | ||||
tight junction protein 2 | Tjp2 | S107 | KVQVAPLQGS*PPLSHDDR | NP_035727 | 0.03 | -0.24 | ||
tight junction protein 2 | Tjp2 | S111 | KVQVAPLQGSPPLS*HDDR | NP_035727 | ||||
tight junction protein 2 | Tjp2 | Y403 | RQQY*SDQDYHSSTEK | NP_035727 | 0.6 | |||
tight junction protein 2 | Tjp2 | S404 | RQQYS*DQDYHSSTEK | NP_035727 | 0.09 | |||
tight junction protein 2 | Tjp2 | S411 | RQQYSDQDYHSS*TEK | NP_035727 | -0.14 | |||
tight junction protein 2 | Tjp2 | S213 | S*IDRDYDRDYER | NP_035727 | ||||
tight junction protein 2 | Tjp2 | S441 | S*TGDITAAGVTEASR | NP_035727 | 0.98 | |||
tight junction protein 2 | Tjp2 | S988 | SQNREDS*FDYSK | NP_035727 | -0.8 | 0.19 | ||
tight junction protein 2 | Tjp2 | Y991 | SQNREDSFDY*SK | NP_035727 | ||||
tight junction protein 2 | Tjp2 | T442 | ST*GDITAAGVTEASR | NP_035727 | 1.06 | 0.58 | -0.17 | |
tight junction protein 2 | Tjp2 | Y238 | SYHEAYEPDYGGGY*SPSYDR | NP_035727 | -0.75 | |||
tight junction protein 2 | Tjp2 | S239 | SYHEAYEPDYGGGYS*PSYDR | NP_035727 | -0.56 | -0.52 | ||
tight junction protein 2 | Tjp2 | S239 | SYHEAYEPDYGGGYS*PSYDRR | NP_035727 | -0.71 | |||
tight junction protein 2 | Tjp2 | S241 | SYHEAYEPDYGGGYSPS*YDRR | NP_035727 | 0.05 | |||
tight junction protein 2 | Tjp2 | Y242 | SYHEAYEPDYGGGYSPSY*DRR | NP_035727 | 0.08 | |||
tight junction protein 2 | Tjp2 | S107 | VQVAPLQGS*PPLSHDDR | NP_035727 | -0.41 | 0.31 | ||
tight junction protein 3 | Tjp3 | S343 | AIAEPES*PGESR | NP_038797 | -0.53 | -0.37 | -0.41 | * |
tight junction protein 3 | Tjp3 | S106 | ASPAS*GHQLSDQEEADHGR | NP_038797 | -0.13 | |||
tight junction protein 3 | Tjp3 | S111 | ASPASGHQLS*DQEEADHGR | NP_038797 | 0.24 | -0.08 | ||
tight junction protein 3 | Tjp3 | T671 | DKHALLDVT*PSAIER | NP_038797 | -5.69 | |||
tight junction protein 3 | Tjp3 | S195 | RNS*EEFGVK | NP_038797 | 0.22 | 0.07 | ||
tight junction protein 3 | Tjp3 | S157 | RSS*GGGSEANGLDLVSGYKR | NP_038797 | 0.89 | |||
tight junction protein 3 | Tjp3 | S311 | S*PEDSQTDSPVETPQPR | NP_038797 | 2.83 | |||
tight junction protein 3 | Tjp3 | S583 | S*REDLSALTR | NP_038797 | ||||
tight junction protein 3 | Tjp3 | S156 | S*SGGGSEANGLDLVSGYK | NP_038797 | -0.28 | |||
tight junction protein 3 | Tjp3 | S356, S359 | VPS*RQS*LEDR | NP_038797 | 0.14 | |||
tight junction protein 3 | Tjp3 | S359 | VPSRQS*LEDR | NP_038797 | 0.36 | |||
tight junction protein 3 | Tjp3 | S356, S359 | YDIYRVPS*RQS*LEDR | NP_038797 | ||||
thymidine kinase 1 | Tk1 | S12, S13 | MSYINLPTVLPS*S*PSK | NP_033413 | 0.36 | |||
transketolase | Tkt | T39, S40 | ISSIQATTAAGSGHPT*S* | NP_033414 | ||||
transketolase | Tkt | S387, T388 | S*T*FAAFFTR | NP_033414 | -0.19 | |||
transketolase | Tkt | T444 | SVPMST*VFYPSDGVATEK | NP_033414 | ||||
transducin-like enhancer protein 3 isoform 1 | Tle3 | S296 | DAPTS*PASVASSSSTPSSK | NP_001077396 | 0.09 | |||
transducin-like enhancer protein 4 | Tle4 | S208 | SSSVS*PSASFR | NP_035730 | 0.07 | |||
talin 1 | Tln1 | S2040 | VLVQNAAGS*QEK | NP_035732 | 1.9 | 2.48 | ||
talin 2 | Tln2 | S2427 | LIS*SAKQVAASTAQLLVACK | NP_001074711 | ||||
toll-like receptor 13 | Tlr13 | S206 | LKYLSLS*R | NP_991389 | ||||
transmembrane and coiled coil domains 3 | Tmcc3 | T176 | SRT*APHCLESSK | NP_742048 | 1.01 | |||
transmembrane protein 211 | Tmem211 | T174, S184, S185 | WQVT*TVQRAAVPFS*S*ETQR | NP_001028600 | <-10 | |||
transmembrane protein 22 | Tmem22 | T67 | GRT*LFGTMDTQP | NP_001094953 | >10 | |||
transmembrane protein 45b | Tmem45b | S275 | LKSDHTYQSALLSGS*DEE | NP_659185 | -0.4 | |||
transmembrane protein 45b | Tmem45b | S273, S275 | SDHTYQSALLS*GS*DEE | NP_659185 | ||||
transmembrane protein 45b | Tmem45b | S273 | SDHTYQSALLS*GSDE | NP_659185 | ||||
transmembrane protein 45b | Tmem45b | S275 | SDHTYQSALLSGS*DE | NP_659185 | ||||
transmembrane protein 45b | Tmem45b | S275 | SDHTYQSALLSGS*DEE | NP_659185 | ||||
transmembrane protein 51 | Tmem51 | S114 | IQQQAGTVPHSQEEDS*QEEEEDVSSR | NP_663377 | 0.35 | 0.05 | ||
transmembrane protein 57 | Tmem57 | S9 | RNADCS*KLR | NP_079658 | ||||
transmembrane protein 66 | Tmem66 | T351 | T*RTASGYGGTRRR | NP_080708 | ||||
transmembrane protein 87A isoform 2 | Tmem87a | Y122, S125 | KGLSGRY*QTS*SR | NP_001103966 | ||||
thymopoietin isoform epsilon | Tmpo | S155, T159 | EQGTES*RSST*PLPTVSSSAENTR | NP_001073598 | ||||
thymopoietin isoform epsilon | Tmpo | S157, T159 | EQGTESRS*ST*PLPTVSSSAENTR | NP_001073598 | 0.02 | |||
thymopoietin isoform epsilon | Tmpo | S158, T159 | EQGTESRSS*T*PLPTVSSSAENTR | NP_001073598 | -0.04 | |||
thymopoietin isoform epsilon | Tmpo | S66 | GPPDFS*SDEEREPTPVLGSGASVGR | NP_001073598 | 0.61 | |||
thymopoietin isoform epsilon | Tmpo | T74 | GPPDFSSDEEREPT*PVLGSGASVGR | NP_001073598 | 0.75 | 0.55 | ||
thymopoietin isoform epsilon | Tmpo | S176, S183 | QNGS*NDSDRYS*DNDEDSKIELK | NP_001073598 | ||||
thymopoietin isoform epsilon | Tmpo | S179 | QNGSNDS*DRYSDNDEDSKIELK | NP_001073598 | 0.91 | |||
thymopoietin isoform epsilon | Tmpo | Y182 | QNGSNDSDRY*SDNDEDSKIELK | NP_001073598 | 0.14 | |||
thymopoietin isoform epsilon | Tmpo | S183 | QNGSNDSDRYS*DNDEDSKIELK | NP_001073598 | 0.1 | |||
thymopoietin isoform epsilon | Tmpo | S157, T159 | S*ST*PLPTVSSSAENTR | NP_001073598 | -0.22 | |||
thymopoietin isoform epsilon | Tmpo | S157 | S*STPLPTVSSSAENTR | NP_001073598 | 0.22 | 0.09 | 0.23 | |
thymopoietin isoform epsilon | Tmpo | S158, T159 | SS*T*PLPTVSSSAENTR | NP_001073598 | -0.29 | |||
thymopoietin isoform epsilon | Tmpo | S158, S167 | SS*TPLPTVSSS*AENTR | NP_001073598 | ||||
thymopoietin isoform epsilon | Tmpo | S158 | SS*TPLPTVSSSAENTR | NP_001073598 | 0.32 | 0.1 | 0.18 | |
thymopoietin isoform epsilon | Tmpo | T159, S167 | SST*PLPTVSSS*AENTR | NP_001073598 | 1.47 | -0.3 | -0.12 | |
thymopoietin isoform epsilon | Tmpo | T159 | SST*PLPTVSSSAENTR | NP_001073598 | 0.89 | 0.03 | -0.16 | |
thymopoietin isoform epsilon | Tmpo | T163 | SSTPLPT*VSSSAENTR | NP_001073598 | 0.21 | -0.32 | ||
thymopoietin isoform alpha | Tmpo | S422 | LSQSSYQDSESLS*PPR | NP_035735 | -0.33 | 0.16 | 1.03 | |
thymopoietin isoform alpha | Tmpo | S183 | QNGSNDSDRYS*DNDEGK | NP_035735 | -0.42 | |||
thymopoietin isoform alpha | Tmpo | S413, S422 | RLSQS*SYQDSESLS*PPR | NP_035735 | 0.68 | |||
thymopoietin isoform alpha | Tmpo | S414, S422 | RLSQSS*YQDSESLS*PPR | NP_035735 | 0.68 | |||
thymosin, beta 10 | Tmsb10 | T23 | TET*QEKNTLPTK | NP_001034481 | 0.08 | |||
thymosin, beta 4, X chromosome | Tmsb4x | T23 | KTET*QEKNPLPSK | NP_067253 | -0.22 | |||
thymosin, beta 4, X chromosome | Tmsb4x | T21 | T*ETQEKNPLPSK | NP_067253 | ||||
thymosin, beta 4, X chromosome | Tmsb4x | T21 | T*ETQEKNPLPSKETIEQEK | NP_067253 | 0.26 | |||
thymosin, beta 4, X chromosome | Tmsb4x | T23 | TET*QEKNPLPSK | NP_067253 | -0.94 | -0.24 | ||
thymosin, beta 4, X chromosome | Tmsb4x | T23 | TET*QEKNPLPSKETIEQEK | NP_067253 | -0.19 | |||
thioredoxin-related transmembrane protein 1 | Tmx1 | S245 | KVEEEQEADEEDVS*EEEAEDR | NP_082615 | 0.93 | 0.27 | ||
thioredoxin-related transmembrane protein 1 | Tmx1 | S245 | KVEEEQEADEEDVS*EEEAEDREGASK | NP_082615 | -0.14 | |||
thioredoxin-related transmembrane protein 1 | Tmx1 | S245 | VEEEQEADEEDVS*EEEAEDREGASK | NP_082615 | 0.95 | 0.21 | ||
tumor necrosis factor alpha induced protein 6 | Tnfaip6 | T221, T226, S231, S234, T236 | YCGDELPEDIIST*GNVMT*LKFLS*DAS*VT*AGGFQIK | NP_033424 | ||||
tumor necrosis factor alpha induced protein 6 | Tnfaip6 | S253 | YVTVDPASKS*SQAK | NP_033424 | ||||
tumor necrosis factor receptor superfamily, member 10b | Tnfrsf10b | T125, T127 | CNITT*NT*VCR | NP_064671 | ||||
tumor necrosis factor receptor superfamily, member 21 | Tnfrsf21 | S7, S15 | MGTRASS*ITALASCS*R | NP_848704 | ||||
TRAF2 and NCK interacting kinase isoform 2 | Tnik | S659 | FDRS*SWLR | NP_001156479 | 5.79 | |||
tankyrase 1 binding protein 1 | Tnks1bp1 | S713 | DRQS*PSTCSEGLLGWAQK | NP_001074729 | 0.42 | |||
tankyrase 1 binding protein 1 | Tnks1bp1 | S866 | DS*LGSFSTR | NP_001074729 | 0.18 | |||
tankyrase 1 binding protein 1 | Tnks1bp1 | S602 | ENYEDQEPLVGHES*PITLAAR | NP_001074729 | -0.49 | |||
tankyrase 1 binding protein 1 | Tnks1bp1 | T533, S539 | GEGVSQVGPGT*PPAPES*PR | NP_001074729 | -0.48 | |||
tankyrase 1 binding protein 1 | Tnks1bp1 | T533, S539 | GEGVSQVGPGT*PPAPES*PRKPISGVQGNDPGISLPQR | NP_001074729 | -0.91 | |||
tankyrase 1 binding protein 1 | Tnks1bp1 | T533 | GEGVSQVGPGT*PPAPESPR | NP_001074729 | 0.08 | |||
tankyrase 1 binding protein 1 | Tnks1bp1 | S496, T503 | LDS*PPPSPIT*EASEAAEAAEADSWAVSGR | NP_001074729 | -1.19 | |||
tankyrase 1 binding protein 1 | Tnks1bp1 | S496, S506 | LDS*PPPSPITEAS*EAAEAAEADSWAVSGR | NP_001074729 | -1.13 | |||
tankyrase 1 binding protein 1 | Tnks1bp1 | S1061 | MQAES*QSPTNVDLEDKER | NP_001074729 | -0.19 | -0.33 | ||
tankyrase 1 binding protein 1 | Tnks1bp1 | S1063 | MQAESQS*PTNVDLEDKER | NP_001074729 | -0.19 | 0.19 | ||
tankyrase 1 binding protein 1 | Tnks1bp1 | S1290 | NMAPGAGCS*PGEPR | NP_001074729 | -0.6 | -0.4 | -0.1 | |
tankyrase 1 binding protein 1 | Tnks1bp1 | S866 | RDS*LGSFSTR | NP_001074729 | 0.41 | 0.07 | ||
tankyrase 1 binding protein 1 | Tnks1bp1 | S429 | RFS*EGVLQPPSQDQEK | NP_001074729 | 1.39 | |||
tankyrase 1 binding protein 1 | Tnks1bp1 | S568 | S*PALLPSTVEGPPGAPLLQAK | NP_001074729 | -0.71 | |||
tankyrase 1 binding protein 1 | Tnks1bp1 | S1375 | SSGSLS*PGLETEDPLEAR | NP_001074729 | 0.08 | |||
tankyrase 1 binding protein 1 | Tnks1bp1 | S1611, S1612 | VPS*S*DEEVVEEPQSR | NP_001074729 | -0.08 | |||
tankyrase 1 binding protein 1 | Tnks1bp1 | S1131 | VSGAGLS*PSR | NP_001074729 | -0.49 | -0.24 | 0.11 | |
tankyrase 1 binding protein 1 | Tnks1bp1 | S692 | WLDDLLAS*PPPNSGSAR | NP_001074729 | -0.28 | |||
trinucleotide repeat containing 6b isoform 1 | Tnrc6b | S1409 | GGS*PYNQFDIIPGDTLGGHTGPAGDSWLPAK | NP_659061 | -0.28 | |||
trinucleotide repeat containing 6b isoform 1 | Tnrc6b | S1793 | MGS*PAPLLPGDLLGGGSDSI | NP_659061 | ||||
tensin 1 | Tns1 | S1062 | AASDGQYENQS*PEATSPR | NP_082160 | -0.1 | |||
tensin 1 | Tns1 | T1066 | AASDGQYENQSPEAT*SPR | NP_082160 | -0.32 | |||
tensin 1 | Tns1 | S1363 | AVNPTMAAPGS*PSLSHR | NP_082160 | -2.04 | |||
tensin 1 | Tns1 | S1365 | AVNPTMAAPGSPS*LSHR | NP_082160 | -2.03 | |||
tensin 1 | Tns1 | S1010 | ETTS*DPSRTPEEEPLNLEGLVAHR | NP_082160 | -0.24 | |||
tensin 1 | Tns1 | T1015 | ETTSDPSRT*PEEEPLNLEGLVAHR | NP_082160 | 0.27 | |||
tensin 1 | Tns1 | S1468 | HLGGSGSVVPGS*PSLDR | NP_082160 | -3.98 | -2.98 | ||
tensin 1 | Tns1 | S1470 | HLGGSGSVVPGSPS*LDR | NP_082160 | -3.82 | |||
tensin 1 | Tns1 | S1535, T1537 | QGS*PT*PALPEKR | NP_082160 | ||||
tensin 1 | Tns1 | S1535 | QGS*PTPALPEKR | NP_082160 | ||||
tensin 1 | Tns1 | S1535 | QGS*PTPALPEKR | NP_082160 | ||||
tensin 1 | Tns1 | S1346 | TVGTNTPPS*PGFGR | NP_082160 | -1.3 | |||
tensin 3 | Tns3 | S769 | KLS*IGQYDNDAASQVTFSK | NP_001077056 | 0.51 | |||
tensin 3 | Tns3 | Y773 | KLSIGQY*DNDAASQVTFSK | NP_001077056 | 0.89 | |||
tensin 3 | Tns3 | S332 | WDS*YENMSADGEVLHTQGPVDGSLYAK | NP_001077056 | 0.13 | |||
translocase of outer mitochondrial membrane 34 | Tomm34 | S186 | SRVPS*AGDVER | NP_080272 | -0.44 | |||
translocase of outer mitochondrial membrane 70 homolog A | Tomm70a | S94 | AS*PALGSGHHDGSGDSLEMSSLDR | NP_613065 | 0.06 | 0.03 | 0.09 | |
translocase of outer mitochondrial membrane 70 homolog A | Tomm70a | S105 | ASPALGSGHHDGS*GDSLEMSSLDR | NP_613065 | 0.1 | |||
translocase of outer mitochondrial membrane 70 homolog A | Tomm70a | S108 | ASPALGSGHHDGSGDS*LEMSSLDR | NP_613065 | ||||
topoisomerase (DNA) II beta | Top2b | S1568 | KTSFDQDS*DVDIFPSDFTSEPPALPR | NP_033435 | 0.91 | |||
topoisomerase (DNA) II beta | Top2b | S1387 | VKAS*PITNDGEDEFVPSDGLDKDEYAFSSGK | NP_033435 | 1.7 | |||
topoisomerase 1-binding RING finger | Topors | S99 | LQQTVPADAS*PDSK | NP_598858 | 0.06 | |||
tumor protein D52 isoform 1 | Tpd52 | T195 | NSPT*FKSFEEK | NP_001020432 | -0.41 | |||
tumor protein D52 isoform 1 | Tpd52 | S198 | NSPTFKS*FEEK | NP_001020432 | -0.36 | -0.39 | ||
tumor protein D52 isoform 1 | Tpd52 | S198 | NSPTFKS*FEEKVENLK | NP_001020432 | ||||
tumor protein D52 isoform 1 | Tpd52 | S198 | S*FEEKVENLK | NP_001020432 | -0.26 | |||
tumor protein D52-like 1 | Tpd52l1 | S149 | NSSTFKS*FEER | NP_033439 | -0.11 | |||
tumor protein D52-like 2 | Tpd52l2 | T177 | NSAT*FKSFEDR | NP_079758 | ||||
tumor protein D52-like 2 | Tpd52l2 | S180 | NSATFKS*FEDR | NP_079758 | -0.13 | |||
triosephosphate isomerase 1 | Tpi1 | S262 | IIYGGS*VTGATCK | NP_033441 | 0.27 | -0.17 | -0.11 | |
triosephosphate isomerase 1 | Tpi1 | T264 | IIYGGSVT*GATCK | NP_033441 | -0.09 | |||
triosephosphate isomerase 1 | Tpi1 | T228 | TAT*PQQAQEVHEK | NP_033441 | ||||
tubulin polymerization-promoting protein family member 2 | Tppp2 | S124, Y126 | LTDTS*KY*TGTHKERFDESGK | NP_001122106 | ||||
nuclear pore complex-associated protein Tpr | Tpr | T2061, S2067 | QT*PQAPQS*PR | NP_598541 | ||||
nuclear pore complex-associated protein Tpr | Tpr | S2067 | QTPQAPQS*PR | NP_598541 | -0.33 | 0.41 | 0.08 | |
nuclear pore complex-associated protein Tpr | Tpr | S2149 | TDGFAEAIHS*PQVAGVPR | NP_598541 | -1.36 | -0.87 | ||
TPX2, microtubule-associated protein homolog | Tpx2 | S737 | SSELPLTVPVS*PK | NP_001135447 | -0.66 | |||
transformer-2 alpha | Tra2a | T200 | AHT*PTPGIYMGR | NP_932770 | 0.06 | |||
transformer-2 alpha | Tra2a | T200 | AHT*PTPGIYMGRPTHSGGGGGGGGGGGGGGGGGGR | NP_932770 | -0.62 | |||
splicing factor, arginine/serine-rich 10 | Tra2b | T201 | HT*PTPGIYMGR | NP_033212 | 0.06 | 0.16 | 0.28 | |
splicing factor, arginine/serine-rich 10 | Tra2b | T203 | HTPT*PGIYMGR | NP_033212 | ||||
splicing factor, arginine/serine-rich 10 | Tra2b | T201 | RPHT*PTPGIY | NP_033212 | 0.02 | 0.03 | ||
splicing factor, arginine/serine-rich 10 | Tra2b | T201 | RPHT*PTPGIYMGR | NP_033212 | -0.47 | 1.18 | ||
splicing factor, arginine/serine-rich 10 | Tra2b | T201 | RPHT*PTPGIYMGRPTYGSSR | NP_033212 | -0.32 | |||
splicing factor, arginine/serine-rich 10 | Tra2b | T203 | RPHTPT*PGIY | NP_033212 | ||||
splicing factor, arginine/serine-rich 10 | Tra2b | S264, S266 | RRS*PS*PYYSR | NP_033212 | 0.09 | |||
splicing factor, arginine/serine-rich 10 | Tra2b | S264, Y268 | RRS*PSPY*YSR | NP_033212 | 0.16 | |||
splicing factor, arginine/serine-rich 10 | Tra2b | S264, Y269 | RRS*PSPYY*SR | NP_033212 | 0.18 | |||
splicing factor, arginine/serine-rich 10 | Tra2b | S264, S266 | RS*PS*PYYSR | NP_033212 | 0.27 | 0.3 | ||
splicing factor, arginine/serine-rich 10 | Tra2b | S264, S266 | S*PS*PYYSR | NP_033212 | -0.35 | 0.35 | ||
splicing factor, arginine/serine-rich 10 | Tra2b | S264 | S*PSPYYSR | NP_033212 | -0.53 | |||
translocating chain-associating membrane protein 1 | Tram1 | S365 | KGTENGVNGTVTSNGADS*PR | NP_082449 | 0.38 | -0.16 | ||
transferrin receptor 2 | Trfr2 | T665 | ERGLT*LQWVYSAR | NP_056614 | ||||
tribbles homolog 3 | Trib3 | S301 | EPS*ERLVALGILLHPWLR | NP_780302 | 3.1 | |||
tripartite motif-containing 24 | Trim24 | S812 | SEWSDASQKS*PVHVGETR | NP_659542 | -0.2 | |||
tripartite motif protein 28 | Trim28 | S824 | FSAVLVEPPPLNLPSAGLSS*QELSGPGDGP | NP_035718 | ||||
tripartite motif protein 28 | Trim28 | S594 | LAS*PSGSTSSGLEVVAPEVTSAPVSGPGILDDSATICR | NP_035718 | -0.44 | |||
tripartite motif protein 28 | Trim28 | S51 | RPAASSAAAASAAASS*PAGGGGEAQELLEHCGVCR | NP_035718 | -0.3 | |||
tripartite motif protein 28 | Trim28 | S471 | S*RSGEGEVSGLLR | NP_035718 | -0.38 | 0.41 | ||
tripartite motif protein 28 | Trim28 | S473 | SRS*GEGEVSGLLR | NP_035718 | -0.25 | 0.39 | ||
tripartite motif protein 28 | Trim28 | S23 | TAASAASGS*PGSGEGSAGGEK | NP_035718 | -0.56 | |||
tripartite motif-containing 41 | Trim41 | T214, S219 | QMHPT*PGRGS*RVNEQGICPR | NP_663352 | ||||
tripartite motif-containing 42 | Trim42 | S137, S138, S142 | TALRVGSSDTQMDEPKTMPAS*S*HLVS*HLTCPMCNR | NP_084495 | ||||
tripartite motif-containing 47 | Trim47 | S306 | GLGS*NEDGLQK | NP_766158 | -0.29 | |||
triple functional domain (PTPRF interacting) | Trio | T1899, S1901, S1911, S1919 | LLVRPT*SS*ETPSAAELVS*AIEELVKS*K | NP_001074771 | ||||
thyroid hormone receptor interactor 10 | Trip10 | S296, S298 | VPS*DS*SLGTPDGRPELR | NP_598886 | -0.4 | |||
thyroid hormone receptor interactor 10 | Trip10 | S296, S299 | VPS*DSS*LGTPDGRPELR | NP_598886 | -0.43 | |||
thyroid hormone receptor interactor 10 | Trip10 | S296 | VPS*DSSLGTPDGRPELR | NP_598886 | -0.52 | -0.19 | -0.11 | |
thyroid hormone receptor interactor 11 | Trip11 | S1141, T1142, S1146 | KMS*T*RFES*SGQDMFKETIQNLSR | NP_082722 | ||||
thyroid hormone receptor interactor 11 | Trip11 | S1888 | LSVHGLKPLDS*PGR | NP_082722 | -0.5 | |||
transformation related protein 53 isoform b | Trp53 | S312 | ALPTCTSAS*PPQK | NP_001120705 | -0.43 | 0.04 | 0.69 | |
transformation related protein 53 isoform b | Trp53 | S312 | ALPTCTSAS*PPQKK | NP_001120705 | 0.13 | |||
transformation related protein 53 isoform b | Trp53 | S37 | LLPPEDILPS*PH | NP_001120705 | ||||
transformation related protein 53 binding protein 1 | Trp53bp1 | S822 | DAVTEDS*PQPPLPSVR | NP_038763 | 0.17 | |||
transformation related protein 53 binding protein 1 | Trp53bp1 | S382 | IVPSS*PTEQGGR | NP_038763 | 0.19 | |||
transformation related protein 53 binding protein 1 | Trp53bp1 | T384 | IVPSSPT*EQGGR | NP_038763 | 0.2 | |||
transformation related protein 53 binding protein 1 | Trp53bp1 | S533 | MESLGS*PR | NP_038763 | -0.23 | 0.13 | ||
transformation related protein 53 binding protein 1 | Trp53bp1 | S1096 | QSEQPVKPVGPVMDDAAPEDSAS*PVSQQR | NP_038763 | 0.01 | |||
transformation related protein 53 binding protein 1 | Trp53bp1 | S267 | SEDRPS*SPQVSVAAVETK | NP_038763 | 0.04 | |||
transformation related protein 53 binding protein 1 | Trp53bp1 | S268 | SEDRPSS*PQVSVAAVETK | NP_038763 | 0.37 | 0.04 | ||
transformation related protein 53 binding protein 1 | Trp53bp1 | S382 | STPFIVPSS*PTEQGGR | NP_038763 | -0.46 | |||
transformation related protein 53 binding protein 1 | Trp53bp1 | S552 | TEEDRENTQIDDTEPLS*PVSNSK | NP_038763 | -0.33 | -0.37 | ||
tumor protein p53 binding protein, 2 | Trp53bp2 | S703 | IPRPLS*PTK | NP_775554 | 0.12 | |||
tumor protein p53 binding protein, 2 | Trp53bp2 | T705 | IPRPLSPT*K | NP_775554 | ||||
tumor protein p53 binding protein, 2 | Trp53bp2 | S485 | KNQS*SEDILR | NP_775554 | ||||
transient receptor potential cation channel, subfamily C, member 2 isoform 1 | Trpc2 | S107 | S*GVRMFK | NP_035774 | ||||
transient receptor potential cation channel, subfamily C, member 5 | Trpc5 | T498 | LISLFT*A | NP_033454 | ||||
transient receptor potential cation channel, subfamily M, member 1 isoform 2 | Trpm1 | S202 | DHS*SKSRGR | NP_001034193 | 12.45 | |||
transient receptor potential cation channel, subfamily M, member 4 | Trpm4 | S527 | NTRDS*YLGQDHR | NP_780339 | 0.08 | |||
TSC22-related inducible leucine zipper 2 | Tsc22d4 | S62 | NGS*PPPGAPASR | NP_076399 | -0.27 | |||
TSR1, 20S rRNA accumulation | Tsr1 | S591 | MS*VLNMVVSRNPGNTEPVKAK | NP_796299 | ||||
tumor-suppressing subchromosomal transferable fragment 4 isoform 1 | Tssc4 | T124 | RPVT*PPSQTPAR | NP_001108557 | 0.24 | -0.14 | 0.26 | |
testis-specific serine kinase 1 | Tssk1 | Y12, S22, Y23, S31 | GY*IMGINLGEGS*Y*AKVKSAYS*ER | NP_033461 | ||||
tetratricopeptide repeat domain 7 | Ttc7 | S46, S47 | MFELARHLQMLGISGGGS*S*NR | NP_082915 | ||||
tetratricopeptide repeat domain 9 | Ttc9 | S15 | SSGNPS*PPALGEGPRPVPPPCVPSGGGAPER | NP_001028321 | ||||
tubulin tyrosine ligase-like family, member 4 | Ttll4 | S1124, S1128, S1131 | S*TPKS*KKS*QAGLSPISR | NP_001014974 | ||||
tubulin tyrosine ligase-like family, member 5 | Ttll5 | S1017 | HHS*GIAKTQKEGEDVSLNRR | NP_001074892 | ||||
tubulin tyrosine ligase-like family, member 8 | Ttll8 | T426 | FST*QRFSLDK | NP_766406 | ||||
titin isoform N2-A | Ttn | T29733, S29741, Y29748 | AGTERWMKVVTLKPT*VLEHTVIS*LNEGEQY*LFR | NP_035782 | ||||
titin isoform N2-A | Ttn | Y15217 | KDHGRY*VITATNSCGSK | NP_035782 | ||||
titin isoform N2-A | Ttn | S22566, S22569, S22571, T22572 | NAAGVFS*EPS*ES*T*GAITAR | NP_035782 | ||||
titin isoform N2-A | Ttn | S32204, T32210 | RRDFRYS*TYHVPT*K | NP_035782 | ||||
titin isoform N2-A | Ttn | S15352, T15353, S15363 | TKS*T*ITLDWKEPRS*DGGSPIQGYIIEK | NP_035782 | ||||
TRAF and TNF receptor associated protein | Ttrap | S6 | MASGSS*SDAAEPAGPAGR | NP_062424 | ||||
tubulin, beta 2 | Tubb2a | S296 | ALTVPELTQQMFDS*K | NP_033476 | ||||
tubulin, beta 2 | Tubb2a | S124 | ES*ESCDCLQGFQLTH | NP_033476 | ||||
tubby-like protein 2 isoform 2 | Tulp2 | T442 | KMT*VILPGMDSRK | NP_001039020 | ||||
thioredoxin reductase 3 | Txnrd3 | S13 | LAS*PGTSRPSSEAR | NP_694802 | ||||
U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2 | U2af2 | S79 | EEHGGLIRS*PR | NP_598432 | 0.1 | |||
U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2 | U2af2 | S79 | GAKEEHGGLIRS*PR | NP_598432 | 0.8 | |||
Nice-4 protein homolog isoform 1 | Ubap2l | S628 | RYPSSISS*SPQKDLTQAK | NP_082751 | 0.55 | |||
Nice-4 protein homolog isoform 1 | Ubap2l | S629 | RYPSSISSS*PQK | NP_082751 | -0.21 | -0.25 | 0.05 | |
Nice-4 protein homolog isoform 1 | Ubap2l | S629 | RYPSSISSS*PQKDLTQAK | NP_082751 | 0.07 | |||
Nice-4 protein homolog isoform 1 | Ubap2l | S482 | STS*APQMSPGSSDNQSSSPQPAQQK | NP_082751 | ||||
Nice-4 protein homolog isoform 1 | Ubap2l | S487, S496 | STSAPQMS*PGSSDNQSS*SPQPAQQK | NP_082751 | -0.14 | |||
Nice-4 protein homolog isoform 1 | Ubap2l | S487, S497 | STSAPQMS*PGSSDNQSSS*PQPAQQK | NP_082751 | -0.09 | |||
Nice-4 protein homolog isoform 1 | Ubap2l | S487 | STSAPQMS*PGSSDNQSSSPQPAQQK | NP_082751 | -0.27 | 0.07 | -0.25 | |
Nice-4 protein homolog isoform 1 | Ubap2l | S490, S496 | STSAPQMSPGS*SDNQSS*SPQPAQQK | NP_082751 | ||||
Nice-4 protein homolog isoform 1 | Ubap2l | S490, S497 | STSAPQMSPGS*SDNQSSS*PQPAQQK | NP_082751 | 0.15 | |||
Nice-4 protein homolog isoform 1 | Ubap2l | S490 | STSAPQMSPGS*SDNQSSSPQPAQQK | NP_082751 | 0.34 | -0.06 | -0.19 | |
Nice-4 protein homolog isoform 1 | Ubap2l | S491, S497 | STSAPQMSPGSS*DNQSSS*PQPAQQK | NP_082751 | ||||
Nice-4 protein homolog isoform 1 | Ubap2l | S491 | STSAPQMSPGSS*DNQSSSPQPAQQK | NP_082751 | 0.34 | 0.06 | ||
Nice-4 protein homolog isoform 1 | Ubap2l | S495 | STSAPQMSPGSSDNQS*SSPQPAQQK | NP_082751 | 0.14 | |||
Nice-4 protein homolog isoform 1 | Ubap2l | S497 | STSAPQMSPGSSDNQSSS*PQPAQQK | NP_082751 | 0.14 | |||
Nice-4 protein homolog isoform 1 | Ubap2l | S627 | YPSSIS*SSPQK | NP_082751 | -0.04 | |||
Nice-4 protein homolog isoform 1 | Ubap2l | S629 | YPSSISSS*PQK | NP_082751 | 1.44 | |||
ubiquitin-conjugating enzyme E2E 3, UBC4/5 homolog | Ube2e3 | S8 | QRS*DDESPSTSSGSSDADQR | NP_033480 | 0.44 | |||
ubiquitin-conjugating enzyme E2E 3, UBC4/5 homolog | Ube2e3 | S8 | QRS*DDESPSTSSGSSDADQRDPAAPEPEEQEER | NP_033480 | -0.87 | |||
ubiquitin-conjugating enzyme E2E 3, UBC4/5 homolog | Ube2e3 | S8 | S*DDESPSTSSGSSDADQRDPAAPEPEEQEER | NP_033480 | 0.06 | |||
ubiquitin-conjugating enzyme E2 variant 1 | Ube2v1 | S146 | LPQPPEGQCYS*N | NP_075719 | ||||
ubiquitin-like 7 | Ubl7 | S230 | DMPGGFLFDGLS*DDEDDFHPSTR | NP_001116345 | -0.02 | |||
upstream binding protein 1 isoform a | Ubp1 | Y300 | RTLPADY* | NP_001076788 | ||||
retinoblastoma-associated factor 600 | Ubr4 | S2715 | HVTLPS*SPR | NP_001153791 | 0.19 | 0.23 | 0.29 | * |
retinoblastoma-associated factor 600 | Ubr4 | S2716 | HVTLPSS*PR | NP_001153791 | 0.24 | 0.29 | 0.21 | * |
retinoblastoma-associated factor 600 | Ubr4 | T4785 | KIDAARRET*R | NP_001153791 | ||||
retinoblastoma-associated factor 600 | Ubr4 | T2881 | T*SPADHGGSVGSESGGSAVDSVAGEHSVSGR | NP_001153791 | -0.2 | |||
retinoblastoma-associated factor 600 | Ubr4 | S2882 | TS*PADHGGSVGSESGGSAVDSVAGEHSVSGR | NP_001153791 | -0.22 | |||
upstream binding transcription factor, RNA polymerase I isoform 2 | Ubtf | Y504, S520 | Y*ERELSEMRAPPAATNS*SK | NP_001037848 | ||||
2B28 | Ubxn1 | S187, S199 | S*SPPATDPGPVPS*SPSQEPPTKR | NP_666205 | -0.91 | |||
2B28 | Ubxn1 | S187, S200 | S*SPPATDPGPVPSS*PSQEPPTKR | NP_666205 | -0.03 | |||
2B28 | Ubxn1 | S187 | S*SPPATDPGPVPSSPSQEPPTK | NP_666205 | -0.18 | |||
2B28 | Ubxn1 | S187 | S*SPPATDPGPVPSSPSQEPPTKR | NP_666205 | 0.39 | 0.15 | ||
2B28 | Ubxn1 | S188, S200 | SS*PPATDPGPVPSS*PSQEPPTK | NP_666205 | -0.91 | |||
2B28 | Ubxn1 | S188, S200 | SS*PPATDPGPVPSS*PSQEPPTKR | NP_666205 | -0.89 | |||
2B28 | Ubxn1 | S188 | SS*PPATDPGPVPSSPSQEPPTK | NP_666205 | -0.16 | |||
2B28 | Ubxn1 | S188 | SS*PPATDPGPVPSSPSQEPPTKR | NP_666205 | -0.09 | -0.34 | 0.04 | |
2B28 | Ubxn1 | T192 | SSPPAT*DPGPVPSSPSQEPPTK | NP_666205 | -0.07 | |||
UBX domain protein 6 | Ubxn6 | S36 | GKS*PQLALR | NP_077752 | -3.47 | |||
uncoupling protein 1 (mitochondrial, proton carrier) | Ucp1 | T265 | EGPT*AFFKGFVASFLR | NP_033489 | ||||
UDP-glucose:glycoprotein glucosyltransferase 2 | Ugcgl2 | Y1375 | Y*HISALYVVDLKK | NP_001074721 | ||||
UDP-glucose dehydrogenase | Ugdh | Y473 | RIPY*TPGEIPK | NP_033492 | -0.36 | |||
UDP-glucose dehydrogenase | Ugdh | T474 | RIPYT*PGEIPK | NP_033492 | -0.37 | |||
UDP glucuronosyltransferase 1 family, polypeptide A9 | Ugt1a9 | T94, S102, S105, S110 | EFKYLSYT*QWKTPEHS*IRS*FLTGS*AR | NP_964006 | ||||
Unc-51-like kinase 1 | Ulk1 | S147 | DLKPQNILLS*NPGGR | NP_033495 | ||||
unc-13 homolog D | Unc13d | S149 | VGVAEGS*PVSR | NP_001009573 | 0.05 | |||
regulator of nonsense transcripts 1 isoform a | Upf1 | S1122 | AYQHGGVTGLS*QY | NP_001116301 | ||||
ubiquinol-cytochrome c reductase core protein 1 | Uqcrc1 | T214 | RLSRT*DLTDYLNR | NP_079683 | ||||
ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 | Uqcrfs1 | S102 | S*SKESSEARK | NP_079986 | ||||
harmonin isoform b3 | Ush1c | S432 | YDS*LQDLRKNK | NP_710143 | ||||
usherin | Ush2a | T1254, Y1273, Y1276 | ISPT*ELRIEWSPPVDSNGIIISY*ELY*MRR | NP_067383 | ||||
USO1 homolog, vesicle docking protein | Uso1 | S940 | LKDLGHPVEEEDES*GDQEDDDDEIDDGDKDQDI | NP_062363 | 0.06 | |||
ubiquitin specific peptidase 10 | Usp10 | T206 | T*CDSPQNPVDFISGPVPDSPFPR | NP_033488 | -0.24 | 0.1 | ||
ubiquitin specific peptidase 10 | Usp10 | S209 | TCDS*PQNPVDFISGPVPDSPFPR | NP_033488 | -0.22 | -0.33 | ||
ubiquitin specific peptidase 15 | Usp15 | S961, S965 | GASAATGIPLES*DEDS*NDNDNDLENENCMHTN | NP_081880 | ||||
ubiquitin specific peptidase 2 isoform Usp2-69 | Usp2 | S504 | CRARKRCIKKFS*VQR | NP_058088 | 17.54 | |||
ubiquitin specific protease 32 | Usp32 | S1371, S1376 | SPSSLSANVTS*SPKGS*PSSSR | NP_001025105 | -1.68 | |||
ubiquitin specific peptidase 52 | Usp52 | S1054, S1055, S1063 | IS*S*KHLTTLKS*TYLK | NP_598753 | ||||
USP6 N-terminal like isoform b | Usp6nl | S398, S399 | SVGRPSPKTS*S*RR | NP_001074017 | ||||
ubiquitin specific peptidase 7 | Usp7 | S19 | AGEQQLS*EPEDMEMEAGDTDDPPR | NP_001003918 | -0.01 | |||
ubiquitin specific peptidase 7 | Usp7 | T398 | FLT*LPPVLHLQLMR | NP_001003918 | 15.72 | |||
ubiquitin specific peptidase 7 | Usp7 | S156 | RIS*HLFFHK | NP_001003918 | ||||
vomeronasal 1 receptor, C7 | V1rc7 | S221 | QCKHLHS*TSHLR | NP_444467 | ||||
vomeronasal 1 receptor, E4 | V1re4 | S169, T170 | KFKVKS*T*K | NP_598954 | ||||
vomeronasal 1 receptor, K1 | V1rk1 | S151 | CRS*SQVRHHTTK | NP_598988 | ||||
vomeronasal 1 receptor, K1 | V1rk1 | S152 | CRSS*QVRHHTTK | NP_598988 | ||||
vasohibin 2 | Vash2 | Y286 | ADIRKELEKY*AR | NP_659128 | ||||
vasodilator-stimulated phosphoprotein | Vasp | S235 | KVS*KQEEASGGPLAPK | NP_033525 | -0.78 | |||
ventral anterior homeobox containing gene 1 | Vax1 | S106, Y113 | TS*FTAEQLY*R | NP_033527 | ||||
versican isoform 1 | Vcan | T1886, S1887 | TLISEISGKPT*S*QSGVR | NP_001074718 | ||||
vinculin | Vcl | S290 | DPNAS*PGDAGEQAIR | NP_033528 | 0.07 | 0.13 | ||
vinculin | Vcl | S346 | GQGAS*PVAMQK | NP_033528 | -0.09 | -0.09 | ||
vinculin | Vcl | S290 | GWLRDPNAS*PGDAGEQAIR | NP_033528 | -0.1 | |||
vinculin | Vcl | S721 | S*LLDASEEAIKK | NP_033528 | ||||
vinculin | Vcl | Y822 | SFLDSGY*R | NP_033528 | 0.04 | |||
VEPH isoform A | Veph1 | S430 | RYS*LDHISK | NP_665819 | ||||
vestigial like 4 | Vgll4 | S58 | TGPPPIS*PSK | NP_808351 | -0.75 | -0.32 | 0.26 | |
vomeronasal receptor Vmn2r19 | Vmn2r19 | S59 | KFS*FK | NP_001098102 | -0.07 | |||
vomeronasal 2, receptor 52 | Vmn2r52 | Y57 | Y*NFKETLNVSKTNK | NP_001098661 | 3.4 | |||
vomeronasal receptor Vmn2r87 | Vmn2r87 | T139, S148 | ADDT*CVIDLTGPS*WK | NP_001096836 | -0.1 | |||
vanin 1 precursor | Vnn1 | S463 | LVS*LKPTSGPVLTIGLFGR | NP_035834 | ||||
vacuolar protein sorting 13C | Vps13c | S1660 | KAVS*ILGDEVFR | NP_796158 | ||||
vacuolar protein sorting 4b | Vps4b | S102 | GNDS*DGEAESDDPEK | NP_033216 | -0.1 | |||
1110059P08Rik protein | Vta1 | Y277 | AQKY*CKYAGSALQYEDVGTAVQNLQK | NP_079694 | ||||
wings apart-like homolog | Wapal | S226 | RTES*PSESCPVK | NP_001004436 | -0.04 | |||
wings apart-like homolog | Wapal | T224 | T*ESPSESCPVK | NP_001004436 | ||||
wings apart-like homolog | Wapal | S226 | TES*PSESCPVK | NP_001004436 | 0.2 | 0.09 | -0.07 | |
wings apart-like homolog | Wapal | S77 | VEEEDTGDPFGFDS*DDESLPVSSK | NP_001004436 | 0.1 | |||
WW domain binding protein 7 | Wbp7 | S784, S787 | VAS*LGS*LPLSGVEEK | NP_083550 | ||||
WD repeat and FYVE domain containing 3 | Wdfy3 | S3317 | RWS*DQLSLDEK | NP_766470 | 7.48 | |||
WD repeat domain 12 | Wdr12 | Y15 | KY*AVDDVPFSIPAAAEVADLSNIINKLLETK | NP_067287 | ||||
WD repeat domain 12 | Wdr12 | S23 | KYAVDDVPFS*IPAAAEVADLSNIINKLLETK | NP_067287 | ||||
WD repeat domain 19 | Wdr19 | S90 | TS*QLDNGMR | NP_700440 | ||||
WD repeat domain 20 | Wdr20a | S357 | RNS*TDSRPVSVTYR | NP_081425 | 0.4 | |||
WD repeat domain 20 | Wdr20a | T358 | RNST*DSRPVSVTYR | NP_081425 | 0.32 | |||
WD repeat domain 20 | Wdr20a | S432 | S*NSLPHSAVSNAASK | NP_081425 | -0.25 | 0.38 | ||
WD repeat domain 20 | Wdr20a | S491 | S*SDKLNLVTK | NP_081425 | -0.01 | |||
WD repeat domain 20 | Wdr20a | S434 | SNS*LPHSAVSNAASK | NP_081425 | -0.25 | 0.13 | ||
WD repeat domain 20 | Wdr20a | S492 | SS*DKLNLVTK | NP_081425 | ||||
WD repeat domain 22 | Wdr22 | S799 | AEEPPAS*PGPK | NP_796241 | -0.89 | |||
WD repeat domain 32 | Wdr32 | T354, T355, S356, T362, S366, S367 | RT*T*S*SSDLTT*TSSS*S*GSR | NP_694807 | -4.32 | |||
WD repeat domain 32 | Wdr32 | T354, T355, S356, T363, S367, S369 | RT*T*S*SSDLTTT*SSSS*GS*R | NP_694807 | ||||
WD repeat domain 33 | Wdr33 | S1204 | DAPRPDHPPHDGHS*PASR | NP_083142 | 0.02 | 0.15 | ||
WD repeat domain 43 | Wdr43 | S657, S658 | DEGVDEDNEEEDEDMEDKEENEEDREVS*S*EK | NP_783570 | ||||
WD repeat domain 44 | Wdr44 | T403 | EYVSNDAT*QSDDEEKLQSQQTDTDGGR | NP_780389 | 0.14 | |||
WD repeat domain 44 | Wdr44 | S405 | EYVSNDATQS*DDEEKLQSQQTDTDGGR | NP_780389 | 0.16 | |||
WD repeat domain 44 | Wdr44 | S563 | VS*PSPSQESLSSSK | NP_780389 | 0.07 | |||
PREDICTED: similar to WD repeat domain 49 | Wdr49 | S160 | VVFLKSS*SR | XP_143339 | 1.69 | |||
WD repeat domain 60 | Wdr60 | S165 | QMAEKVEKKAS*K | NP_666151 | ||||
WD repeat domain 70 | Wdr70 | S641 | TMFAQVES*DDEESKNEPEWK | NP_001074871 | 0.25 | |||
Wolfram syndrome 1 protein homolog | Wfs1 | S32 | LNATAS*LEQDKIEPPR | NP_035846 | 0.23 | |||
Wolf-Hirschhorn syndrome candidate 1-like 1 isoform 1 | Whsc1l1 | S568 | SEKPAQS*ASSPEATSGSAGPVEK | NP_001001735 | 0.56 | |||
Wolf-Hirschhorn syndrome candidate 1-like 1 isoform 1 | Whsc1l1 | S570 | SEKPAQSAS*SPEATSGSAGPVEK | NP_001001735 | 0.14 | |||
WD repeat domain, phosphoinositide interacting 2 | Wipi2 | S394 | GAYVPS*SPTR | NP_848485 | -0.1 | |||
WD repeat domain, phosphoinositide interacting 2 | Wipi2 | S395 | GAYVPSS*PTR | NP_848485 | -0.02 | 0.17 | -0.11 | |
WD repeat domain, phosphoinositide interacting 2 | Wipi2 | T397 | GAYVPSSPT*R | NP_848485 | -0.07 | |||
widely-interspaced zinc finger motifs isoform 2 | Wiz | S317, S322 | SPQLSLS*PRPTS*PK | NP_035847 | -0.94 | |||
WNK lysine deficient protein kinase 1 | Wnk1 | S2022 | GTEDGS*GSPHSPPHLCSK | NP_941992 | -0.02 | |||
WNK lysine deficient protein kinase 1 | Wnk1 | S2027 | GTEDGSGSPHS*PPHLCSK | NP_941992 | 0.08 | |||
PREDICTED: similar to Serine/threonine-protein kinase WNK3 (Protein kinase with no lysine 3) (Protein kinase, lysine-deficient 3) | Wnk3 | S142 | TEKEMEEEAEMKAVATSPS*GRFLK | XP_001481348 | ||||
Werner helicase interacting protein 1 | Wrnip1 | S153 | PAAAAAAGSAS*PR | NP_084491 | -0.96 | |||
Werner helicase interacting protein 1 | Wrnip1 | S75 | RLS*ESSALK | NP_084491 | ||||
Werner helicase interacting protein 1 | Wrnip1 | S153 | RPAAAAAAGSAS*PR | NP_084491 | 0.12 | |||
WW, C2 and coiled-coil domain containing 1 | Wwc1 | T885, S887 | ETNT*DS*VAPSPTVVRPK | NP_740749 | -4.09 | |||
WW, C2 and coiled-coil domain containing 1 | Wwc1 | T885, S891 | ETNT*DSVAPS*PTVVRPK | NP_740749 | -2.69 | |||
xin actin-binding repeat containing 1 | Xirp1 | T363 | GERET*EAEVPPK | NP_001074808 | ||||
X-ray repair complementing defective repair in Chinese hamster cells 1 | Xrcc1 | S445, T452 | TQAAGPS*SPPRPPT*PK | NP_033558 | -0.52 | |||
X-ray repair complementing defective repair in Chinese hamster cells 1 | Xrcc1 | S446, T452 | TQAAGPSS*PPRPPT*PK | NP_033558 | 0.04 | -0.22 | 0.04 | |
X-ray repair complementing defective repair in Chinese hamster cells 3 | Xrcc3 | T163 | LRT*DAPEELIEKIR | NP_083151 | 3.9 | 6.23 | 6.2 | * |
5'-3' exoribonuclease 2 | Xrn2 | S499, S501 | AEDS*DS*EPEPEDNVR | NP_036047 | 0.61 | |||
5'-3' exoribonuclease 2 | Xrn2 | S499, S501 | KAEDS*DS*EPEPEDNVR | NP_036047 | 0.16 | |||
5'-3' exoribonuclease 2 | Xrn2 | S448 | NS*PGCQVASNPR | NP_036047 | -1.19 | |||
yes-associated protein 1 | Yap1 | S113 | AHSS*PASLQLGAVSPGTLTASGVVSGPAAAPAAQHLR | NP_033560 | 1.53 | |||
yes-associated protein 1 | Yap1 | S94, T95 | QAS*T*DAGTAGALTPQHVR | NP_033560 | ||||
yes-associated protein 1 | Yap1 | S94 | QAS*TDAGTAGALTPQHVR | NP_033560 | ||||
yes-associated protein 1 | Yap1 | S94 | QAS*TDAGTAGALTPQHVR | NP_033560 | 0.82 | |||
nuclease sensitive element binding protein 1 | Ybx1 | S312 | AADPPAENSS*APEAEQGGAE | NP_035862 | ||||
nuclease sensitive element binding protein 1 | Ybx1 | S172 | NEGS*ESAPEGQAQQR | NP_035862 | -0.34 | -0.07 | ||
nuclease sensitive element binding protein 1 | Ybx1 | S174 | NEGSES*APEGQAQQR | NP_035862 | -0.13 | -0.07 | ||
nuclease sensitive element binding protein 1 | Ybx1 | S163 | NYQQNYQNS*ESGEKNEGSESAPEGQAQQR | NP_035862 | 0.42 | -0.54 | ||
nuclease sensitive element binding protein 1 | Ybx1 | S165 | NYQQNYQNSES*GEKNEGSESAPEGQAQQR | NP_035862 | 0.48 | |||
nuclease sensitive element binding protein 1 | Ybx1 | S172 | NYQQNYQNSESGEKNEGS*ESAPEGQAQQR | NP_035862 | 0.48 | -0.29 | ||
nuclease sensitive element binding protein 1 | Ybx1 | S174 | NYQQNYQNSESGEKNEGSES*APEGQAQQR | NP_035862 | -0.08 | -0.34 | ||
nuclease sensitive element binding protein 1 | Ybx1 | S312 | PPAENSS*APEAEQGGAE | NP_035862 | ||||
nuclease sensitive element binding protein 1 | Ybx1 | S163 | YQNS*ESGEKNEGSESAPEGQAQQR | NP_035862 | 0.3 | |||
YTH domain containing 1 | Ythdc1 | S309 | GIS*PIVFDR | NP_808348 | -0.1 | 0.3 | 0.34 | |
YTH domain containing 1 | Ythdc1 | S425 | LSSESHHGGS*PIHWVLPAGMSAK | NP_808348 | 0.07 | 0.06 | ||
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide | Ywhaz | S207 | TAFDEAIAELDTLS*EESYK | NP_035870 | 0.15 | |||
zonadhesin | Zan | S3466 | DISPKVPSTCKEGCVCQSGYVLNS*DK | NP_035871 | ||||
zinc finger and BTB domain containing 20 | Zbtb20 | S436, S439, S449 | S*NES*EMDNTVITVS*NSSDK | NP_062752 | ||||
zinc finger and BTB domain containing 24 | Zbtb24 | S276, T277 | DYKLLGDEDDQS*T*AKRLCGR | NP_700447 | ||||
zinc finger CCCH type containing 11A | Zc3h11a | S289 | KLS*VGGDSDPPLKR | NP_653113 | ||||
RIKEN cDNA 3110050K21 | Zc3h13 | S242 | AAVVAS*PLLDQQR | NP_080359 | -0.42 | |||
RIKEN cDNA 3110050K21 | Zc3h13 | S1069 | GNLETHEDSQVFS*PK | NP_080359 | ||||
RIKEN cDNA 3110050K21 | Zc3h13 | S77 | RS*PERPTGDLR | NP_080359 | 0.3 | |||
RIKEN cDNA 3110050K21 | Zc3h13 | S951 | S*LSPSHLTEDR | NP_080359 | 0.82 | |||
RIKEN cDNA 3110050K21 | Zc3h13 | S953 | SLS*PSHLTEDR | NP_080359 | -0.23 | 0.75 | ||
zinc finger CCCH-type containing 14 isoform b | Zc3h14 | S409 | IS*PPVKEEEAKGDNTGK | NP_001008506 | ||||
zinc finger CCCH-type containing 14 isoform a | Zc3h14 | S515 | DLVQPDKPAS*PK | NP_083610 | -0.09 | 0.01 | -0.11 | |
conserved nuclear protein Nhn1 isoform a | Zc3h18 | S554 | LGVSVS*PSR | NP_001025164 | -0.65 | 0.02 | 0.03 | |
conserved nuclear protein Nhn1 isoform a | Zc3h18 | S58, S71 | VQS*QEETRSDEEDRAS*EPK | NP_001025164 | 0.51 | |||
conserved nuclear protein Nhn1 isoform a | Zc3h18 | T62 | VQSQEET*RSDEEDRASEPK | NP_001025164 | -0.03 | |||
conserved nuclear protein Nhn1 isoform a | Zc3h18 | S64, S71 | VQSQEETRS*DEEDRAS*EPK | NP_001025164 | ||||
conserved nuclear protein Nhn1 isoform a | Zc3h18 | S64 | VQSQEETRS*DEEDRASEPK | NP_001025164 | -0.09 | |||
zinc finger CCCH-type containing 4 | Zc3h4 | T1052, S1065 | AAKPCPT*EASPPAASPSGDS*SPPATAPYDPR | NP_941033 | 0.13 | |||
zinc finger CCCH-type containing 4 | Zc3h4 | T1052, S1066 | AAKPCPT*EASPPAASPSGDSS*PPATAPYDPR | NP_941033 | -0.1 | |||
zinc finger CCCH-type containing 4 | Zc3h4 | S1055, S1065 | AAKPCPTEAS*PPAASPSGDS*SPPATAPYDPR | NP_941033 | -0.1 | |||
zinc finger CCCH-type containing 4 | Zc3h4 | S1055, S1066 | AAKPCPTEAS*PPAASPSGDSS*PPATAPYDPR | NP_941033 | 0.58 | -0.1 | ||
zinc finger CCCH-type containing 4 | Zc3h4 | S873 | AEGSLHSSPAGPS*SSK | NP_941033 | ||||
zinc finger CCCH-type containing 4 | Zc3h4 | Y109 | DY*SPPYAPSHQQYSSSHNAPLPK | NP_941033 | 0.32 | |||
zinc finger CCCH-type containing 4 | Zc3h4 | S110 | DYS*PPYAPSHQQYSSSHNAPLPK | NP_941033 | 0.32 | |||
zinc finger CCCH-type containing 4 | Zc3h4 | T1219, S1227 | TGT*GSPFAGNS*PAR | NP_941033 | -0.23 | |||
zinc finger CCCH-type containing 4 | Zc3h4 | S1221, S1227 | TGTGS*PFAGNS*PAR | NP_941033 | 0.06 | 0.18 | -7.76 | |
zinc finger, AN1-type domain 5 | Zfand5 | S48 | MS*PMGTASGSNSPTSDSASVQR | NP_033577 | 0.09 | |||
zinc finger, AN1-type domain 5 | Zfand5 | T52 | MSPMGT*ASGSNSPTSDSASVQR | NP_033577 | 1.06 | |||
zinc finger protein 148 | Zfp148 | S783 | AGMTS*SPDATTGQTFG | NP_035879 | ||||
zinc finger protein 148 | Zfp148 | S784 | AGMTSS*PDATTGQTFG | NP_035879 | ||||
zinc finger protein 148 | Zfp148 | T788 | AGMTSSPDAT*TGQTFG | NP_035879 | ||||
zinc finger protein 148 | Zfp148 | S306 | GGLLTSEEDSGFSTS*PK | NP_035879 | 0.47 | |||
GLI-Kruppel family member HKR1 | Zfp169 | S510 | AFVKQS*MLIR | NP_080726 | ||||
zinc finger protein 185 isoform b | Zfp185 | S151 | RS*SISGTEEEEVPFTPDEQK | NP_001102513 | 0.33 | |||
zinc finger protein 185 isoform b | Zfp185 | S151 | RS*SISGTEEEEVPFTPDEQKR | NP_001102513 | ||||
zinc finger protein 185 isoform b | Zfp185 | S152 | RSS*ISGTEEEEVPFTPDEQKR | NP_001102513 | -0.07 | |||
zinc finger protein 185 isoform b | Zfp185 | S154 | RSSIS*GTEEEEVPFTPDEQK | NP_001102513 | 0.19 | |||
zinc finger protein 185 isoform b | Zfp185 | T156 | RSSISGT*EEEEVPFTPDEQK | NP_001102513 | 0.61 | |||
zinc finger protein 292 | Zfp292 | S2027, S2033, S2034, T2039 | S*PEKPES*S*SQPVT*SSAEQYNANLANLKTK | NP_038917 | ||||
zinc finger protein 292 | Zfp292 | S2027, S2034, S2040, S2041 | S*PEKPESS*SQPVTS*S*AEQYNANLANLKTK | NP_038917 | ||||
zinc finger protein 292 | Zfp292 | S2027, S2035, T2039, S2041 | S*PEKPESSS*QPVT*SS*AEQYNANLANLKTK | NP_038917 | ||||
zinc finger protein 318 isoform 2 | Zfp318 | S732 | TKNS*PPFLK | NP_067321 | ||||
zinc finger protein 326 | Zfp326 | T450 | RESVLTAT*SILNNPIVKARYER | NP_061229 | ||||
zinc finger protein 369 | Zfp369 | S566, S574 | SNNSMLQGSS*AQNHQMGS*RAGR | NP_848141 | -0.34 | |||
zinc finger protein 36, C3H type-like 1 | Zfp36l1 | S54 | RHS*VTLPSSK | NP_031590 | 0.55 | |||
zinc finger protein 36, C3H type-like 2 | Zfp36l2 | S480 | LS*ISDD | NP_001001806 | ||||
zinc finger protein 422 | Zfp422 | S177, S180 | CFS*QSS*HLR | NP_080333 | ||||
zinc finger protein 462 | Zfp462 | S674, S681 | ANRKLAS*DFPLDLS*PVKK | NP_766455 | ||||
zinc finger protein 507 | Zfp507 | S573 | TGIS*MSLLTVIEKLRER | NP_808407 | ||||
zinc finger protein 51 | Zfp51 | S451 | SFIHSS*HLRR | NP_033584 | ||||
zinc finger protein 518 | Zfp518 | S751, S754 | WNDIPS*AGS*PMMPR | NP_082595 | <-10 | |||
zinc finger protein 52 | Zfp52 | S424 | SFLRISS*VRIR | NP_653098 | ||||
zinc finger protein 532 | Zfp532 | S109, S117 | DGAKS*LKGDTPAS*EVTLK | NP_997138 | ||||
zinc finger protein 532 | Zfp532 | S267, S283 | TKPSSKLS*SCIAAIAALSAKKAAS*DSCK | NP_997138 | ||||
zinc finger protein 608 | Zfp608 | S420 | FCES*PTSDLEMR | NP_786927 | -8.46 | |||
zinc finger protein 609 | Zfp609 | S575, S577 | LVEPHS*PS*PSSK | NP_766124 | -0.29 | |||
zinc finger protein 609 | Zfp609 | S575 | LVEPHS*PSPSSK | NP_766124 | 0.21 | |||
zinc finger protein 664 | Zfp664 | S181, S185 | AFS*QSSS*LCIHQR | NP_001075219 | ||||
zinc finger protein 7 | Zfp7 | S148, T149 | NS*T*KDAVQERK | NP_666021 | ||||
zinc finger protein 771 | Zfp771 | T77 | RST*LAK | NP_796336 | 19.43 | |||
zinc finger protein 91 | Zfp91 | Y79 | EY*PRRRR | NP_443735 | ||||
zinc finger protein 91 | Zfp91 | S252 | KS*GKVKEEK | NP_443735 | -28.51 | |||
zinc finger protein 91 | Zfp91 | S86, S106 | RSS*PSNRPPDGPGHQPAAAKPPS*PAQGK | NP_443735 | 0.38 | -0.62 | ||
zinc finger, FYVE domain containing 19 | Zfyve19 | S280 | VTLQDYHLPDS*DEDEETAIQR | NP_082330 | -0.33 | 0.04 | ||
zinc finger, FYVE domain containing 9 | Zfyve9 | Y397, Y399, T400, T416, S422 | NY*QY*T*LPVVQGLVVDMEVRKT*SIKIPS*NR | NP_899123 | >10 | |||
zinc finger, MYND-type containing 8 | Zmynd8 | S449 | RIS*LSDMPR | NP_081506 | 0.46 | 1.2 | ||
zinc finger, MYND-type containing 8 | Zmynd8 | S676 | S*NSPVSEKPDPTPAK | NP_081506 | -0.23 | -0.11 | ||
zinc finger, MYND-type containing 8 | Zmynd8 | S678 | SNS*PVSEKPDPTPAK | NP_081506 | 0.12 | -0.08 | -0.05 | |
zinc finger, MYND-type containing 8 | Zmynd8 | S678 | SNS*PVSEKPDPTPAKDK | NP_081506 | -0.19 | |||
zinc finger, MYND-type containing 8 | Zmynd8 | S681 | SNSPVS*EKPDPTPAK | NP_081506 | ||||
PREDICTED: similar to mKIAA1196 protein | Znf512b | T925 | RRMKDDLVPET*AR | XP_982556 | ||||
zinc and ring finger 2 | Znrf2 | S231 | S*CPEHPSD | NP_954594 | ||||
zona pellucida glycoprotein 2 | Zp2 | S450 | NS*EFRMTVR | NP_035905 | 6.9 | |||
zinc finger, RAN-binding domain containing 2 | Zranb2 | S120 | EES*DGEYDEFGR | NP_059077 | 0.01 | |||
zinc finger, RAN-binding domain containing 2 | Zranb2 | S120 | ENVEYIEREES*DGEYDEFGR | NP_059077 | 0.41 | -0.13 | ||
zinc finger, RAN-binding domain containing 2 | Zranb2 | Y124 | ENVEYIEREESDGEY*DEFGR | NP_059077 | 0.28 | |||
zinc finger, RAN-binding domain containing 2 | Zranb2 | S153 | EVEDKES*EGEEEDEDEDLSK | NP_059077 | 1.57 | -0.03 | -0.14 | |
zinc finger, RAN-binding domain containing 2 | Zranb2 | S188 | YNLDAS*EEEDSNK | NP_059077 | 0.19 | -0.13 | ||
zinc finger, ZZ domain containing 3 | Zzz3 | S96 | RLS*SSEKDDLER | NP_001074224 | ||||
zinc finger, ZZ domain containing 3 | Zzz3 | S98 | RLSSS*EKDDLER | NP_001074224 | ||||
PREDICTED: hypothetical protein LOC66835 | 0610007N19Rik | S135 | ES*ASRQSPGR | XP_001475397 | ||||
RAD26L hypothetical protein isoform 1 | 0610007P08Rik | T989, S990 | QRATT*S*LKFK | NP_001013626 | ||||
hypothetical protein LOC104457 | 0610010K14Rik | S62 | VYEDSGIPLPAES*PK | NP_081033 | 0.38 | |||
small acidic protein | 1110004F10Rik | S17 | RSAS*PDDDLGSSNWEAADLGNEER | NP_062746 | 0.47 | |||
small acidic protein | 1110004F10Rik | S15 | S*ASPDDDLGSSNWEAADLGNEER | NP_062746 | 0.22 | 0.14 | -0.07 | |
small acidic protein | 1110004F10Rik | S17 | SAS*PDDDLGSSNWEAADLGNEER | NP_062746 | 0.39 | -0.13 | -0.07 | |
small acidic protein | 1110004F10Rik | S24 | SASPDDDLGS*SNWEAADLGNEER | NP_062746 | 0.43 | |||
hypothetical protein LOC73737 | 1110008P14Rik | S82 | LEFQQQLGEAPGDAS*P | NP_932118 | ||||
hypothetical protein LOC68617 isoform 1 | 1110012J17Rik | T243, S245, S246, S248 | GAPT*PS*S*GS*R | NP_001107570 | -9999 | |||
hypothetical protein LOC66179 | 1110031I02Rik | T24 | RAT*STKKDR | NP_079678 | ||||
hypothetical protein LOC66185 | 1110037F02Rik | S1627 | SFLSEPS*SPGR | NP_001074652 | 0.16 | |||
hypothetical protein LOC66185 | 1110037F02Rik | S1628 | SFLSEPSS*PGR | NP_001074652 | -0.32 | |||
hypothetical protein LOC66202 | 1110059G10Rik | S50 | IQPQLPDEDGNHS*DKEDEQPQVVVLK | NP_079695 | 0.37 | |||
hypothetical protein LOC66202 | 1110059G10Rik | S50 | KIQPQLPDEDGNHS*DKEDEQPQVVVLK | NP_079695 | -0.42 | |||
hypothetical protein LOC66202 | 1110059G10Rik | S150 | NSSLLSFDS*EDENE | NP_079695 | ||||
hypothetical protein LOC67467 | 1200011I18Rik | S146 | GREDPGQVSSFFNSEEAES*GEDEDIVGPMPAK | NP_080453 | 0.38 | |||
hypothetical protein LOC219189 | 1300010F03Rik | T1396, T1399, Y1401 | RSSSLRQPSVT*SMT*MY*TGK | NP_082182 | ||||
hypothetical protein LOC74157 | 1300018I05Rik | S27 | HLS*STSDDEPLSSVNHAAK | NP_083067 | -0.27 | |||
hypothetical protein LOC74157 | 1300018I05Rik | S28 | HLSS*TSDDEPLSSVNHAAK | NP_083067 | -0.27 | |||
calcium binding protein P22 | 1500003O03Rik | T7 | AST*LLRDEELEEIKK | NP_062743 | 0.13 | -0.32 | ||
hypothetical protein LOC68075 | 1520402A15Rik | T188, T190, S194, T196 | ARTEVDMT*ST*KLGS*LT*ATWK | NP_080823 | ||||
hypothetical protein LOC75471 | 1700009N14Rik | S135 | AKS*IVFHR | NP_001074564 | ||||
hypothetical protein LOC67082 | 1700011H14Rik | S171, S174 | QEAQMELRKS*LLS*KAMLDMQK | NP_080232 | ||||
hypothetical protein LOC67851 | 1700021F05Rik | S106 | EADEEDS*DEETSYPER | NP_080687 | -0.04 | |||
CBF1 interacting corepressor | 1700023B02Rik | Y411 | SRSRSPY*RQK | NP_080130 | ||||
hypothetical protein LOC242594 | 1700024P16Rik | S288, T289, S297 | KS*T*KSPATEGS*HR | NP_001156452 | ||||
hypothetical protein LOC75623 | 1700029F09Rik | S2 | MS*HTEVKLK | NP_083644 | ||||
hypothetical protein LOC69528 | 1700030J22Rik | S397 | VFPKPLLPSLTVS*R | NP_081379 | ||||
PREDICTED: hypothetical protein LOC73433 | 1700048O14Rik | S81, S95, S97 | IS*TFATLTKDPVVYAS*CS*PFR | XP_001477145 | ||||
hypothetical protein LOC76719 | 1700081L11Rik | S249 | LS*PSTDSSSNLTNVK | NP_001074514 | 0.26 | |||
PREDICTED: hypothetical protein LOC74284 | 1700086L19Rik | S107 | VTPS*RKNR | XP_358420 | ||||
GC-rich sequence DNA-binding factor candidate | 1810007M14Rik | S264 | LVREDENDAS*DDEDDDEKRR | NP_080386 | -0.23 | |||
hypothetical protein LOC69123 | 1810022C23Rik | T228 | IMGPTKAAEMLLFGKKLT*AR | NP_081223 | ||||
hypothetical protein LOC72097 | 2010300C02Rik | S189 | ILVSSSRPQS*PDHMSDASISSR | NP_082372 | -0.22 | |||
trypsinogen 7 | 2210010C04Rik | Y236 | Y*VNWIQQTIAAN | NP_075822 | ||||
hypothetical protein LOC70088 | 2310005N01Rik | S90, S92, S93, S96 | EAERLFS*KS*S*VTS*AAAVSALAGVQDQLIEK | NP_081586 | ||||
hypothetical protein LOC76448 | 2310014H01Rik | S510 | SCLVKGS*PER | NP_001140182 | -0.04 | |||
hypothetical protein LOC67862 | 2310033P09Rik | S232 | HSDFS*PCSK | NP_077172 | 0.42 | |||
hypothetical protein LOC227446 isoform 2 | 2310035C23Rik | S398 | DSEDNRQS*PAVNSSDQEK | NP_083625 | -1.22 | |||
Nezha | 2310057J16Rik | S431 | SVS*SDSLGPPRPVSTSSR | NP_081447 | ||||
hypothetical protein LOC66508 | 2400001E08Rik | S26, T28 | KLLLDPS*ST*PTKALNGAEPNYHSLPSAR | NP_079881 | -9999 | |||
hypothetical protein LOC66508 | 2400001E08Rik | T28 | KLLLDPSST*PTK | NP_079881 | 0.17 | |||
hypothetical protein LOC66421 | 2410004B18Rik | S156 | LLPEGEETVES*DDDKDER | NP_079831 | 0.61 | |||
hypothetical protein LOC69239 | 2610034M16Rik | S236 | EIMVEYIS*KK | NP_081277 | >10 | |||
hypothetical protein LOC67148 | 2610204K14Rik | S36 | RPPES*PPIVEEWNSR | NP_080273 | -2.51 | 0.13 | ||
p30 DBC protein | 2610301G19Rik | S612 | DEVQNEGTAAESDS*PLKEDGLLPK | NP_666167 | 0.07 | |||
p30 DBC protein | 2610301G19Rik | S222 | HDLS*PYR | NP_666167 | 0.42 | |||
p30 DBC protein | 2610301G19Rik | S674, S677 | S*VAS*NQSEMEYSSLQDMPK | NP_666167 | -5.84 | |||
p30 DBC protein | 2610301G19Rik | S610 | VSKDEVQNEGTAAES*DSPLKEDGLLPK | NP_666167 | 0.01 | |||
p30 DBC protein | 2610301G19Rik | S612 | VSKDEVQNEGTAAESDS*PLKEDGLLPK | NP_666167 | 0.63 | |||
hypothetical protein LOC112422 | 2610305D13Rik | S341, Y343, S344 | IHSEKKPS*KY*S*ECEK | NP_659544 | ||||
hypothetical protein LOC214764 isoform 2 | 2700050L05Rik | Y55, S57 | AVVKY*SS*APPRTAFAR | NP_835216 | ||||
hypothetical protein LOC243219 | 2900026A02Rik | S302 | KRQS*LYENQA | NP_766472 | 0.16 | |||
hypothetical protein LOC243219 | 2900026A02Rik | S205 | RDES*DEEPPRVER | NP_766472 | 1.64 | |||
RIKEN cDNA 2900064A13 | 2900064A13Rik | S230 | GSS*KTGKSGAGK | NP_598510 | ||||
PTIP-associated 1 | 2900092E17Rik | S236 | DLFSLDSEGPSPTS*PPLR | NP_084516 | -0.11 | |||
hypothetical protein LOC68067 | 3010026O09Rik | S139 | TQLSTSAERPS*SPAQPR | NP_080819 | -0.12 | |||
hypothetical protein LOC68067 | 3010026O09Rik | S140 | TQLSTSAERPSS*PAQPR | NP_080819 | -0.57 | |||
PREDICTED: similar to Uncharacterized protein C10orf71 | 3425401B19Rik | T300, S304 | ERKDIAET*TPES*KAPK | XP_484361 | ||||
cytokine-like nuclear factor n-pac isoform 1 | 3930401K13Rik | S130 | KLS*LSEGK | NP_001073282 | ||||
paralemmin 3 | 4432412L15Rik | S139 | EGPRPLS*QSAMEAAPTAPTDVDKR | NP_083153 | -1.5 | |||
paralemmin 3 | 4432412L15Rik | S270 | QGTSS*PELPTWVK | NP_083153 | -0.2 | |||
pyruvate dehydrogenase phosphatase isoenzyme 2 | 4833426J09Rik | S2, S6, Y7 | MS*STVS*Y*WIFNSAR | NP_001019777 | ||||
hypothetical protein LOC97820 | 4833439L19Rik | S183 | HPASAQSTPSSTPHAS*PK | NP_598558 | -1.24 | |||
PREDICTED: hypothetical protein LOC232664 isoform 1 | 4921511K06Rik | T681 | LT*FPQPKCGILQK | XP_485735 | ||||
pyruvate dehydrogenase phosphatase regulatory subunit | 4930402E16Rik | Y3 | MLY*RLLSIVQRQR | NP_938050 | ||||
PREDICTED: similar to LOC500668 protein | 4930403N07Rik | Y371 | EKLSTLLKQY*K | XP_921924 | 0.73 | |||
PREDICTED: hypothetical protein LOC68179 | 4930408G06Rik | S1295 | NESYFMREDS*EEQMKYLK | XP_619629 | ||||
hypothetical protein LOC242408 | 4930412F15Rik | T287, S288 | AGGVT*S*RPVVPAKRAELVEMAK | NP_780726 | ||||
hypothetical protein LOC74855 | 4930417G10Rik | S200, T207 | GAS*SEKPVFT*LK | NP_083383 | ||||
prematurely terminated mRNA decay factor-like | 4930422G04Rik | Y66 | GACLESLFLKCLEVKPGDDLESERY*LITVEEAKAVGSR | NP_932114 | ||||
hypothetical protein LOC74653 | 4930444A02Rik | T110 | LT*RLEMK | NP_083313 | 7.92 | |||
hypothetical protein LOC76916 | 4930455C21Rik | T151, T154, Y159 | WSWRTAVFVTIFNT*VNT*GLTVY*R | NP_077235 | -5.16 | |||
hypothetical protein LOC71653 isoform 1 | 4930506M07Rik | S506 | S*MPVLGSVSSVTK | NP_001107784 | -0.28 | |||
hypothetical protein LOC108978 | 4930555G01Rik | T176 | LLVEQAGT*QVSCGEEK | NP_780602 | ||||
hypothetical protein LOC231045 | 4931409K22Rik | T204, S212, Y220 | MLVQAVCTET*GANLFDLS*PDNLMGKY*PGK | NP_808344 | ||||
hypothetical protein LOC238663 | 4932411G14Rik | T1213, T1220 | AGKVPQGT*PPFAVGT*MLADMSR | NP_808379 | ||||
PREDICTED: hypothetical protein LOC71030 | 4933403O08Rik | S150, T151, S155, T161 | QASPRTLSPFS*T*HAVS*SAQKIT*LQAAR | XP_136029 | ||||
hypothetical protein LOC71149 | 4933413G19Rik | T21 | T*REPFLK | NP_081973 | ||||
Rho GTPase activating protein 23 | 4933428G20Rik | S516 | ARS*LSLSKERR | NP_067468 | ||||
hypothetical protein LOC66780 | 4933436I01Rik | S34 | IFLKPVSRGS*GK | NP_080039 | 7.92 | |||
hypothetical protein LOC227545 | 5430407P10Rik | S220, S223 | LAGNEALS*PTS*PSK | NP_001153129 | -4.66 | -1.07 | ||
hypothetical protein LOC227545 | 5430407P10Rik | S223 | LAGNEALSPTS*PSK | NP_001153129 | 0.17 | |||
hypothetical protein LOC70567 | 5730455O13Rik | S243 | TTPECDES*PR | NP_001074544 | 1.45 | |||
hypothetical protein LOC67788 | 6330577E15Rik | S67, T70 | ENPPS*PPT*SPAAPQPR | NP_080653 | 0.06 | 0 | 0.05 | |
hypothetical protein LOC67788 | 6330577E15Rik | S67, S71 | ENPPS*PPTS*PAAPQPR | NP_080653 | -0.1 | -0.07 | 0.08 | |
hypothetical protein LOC67788 | 6330577E15Rik | S67 | ENPPS*PPTSPAAPQPR | NP_080653 | -0.02 | 0.48 | ||
hypothetical protein LOC67788 | 6330577E15Rik | T70, S71 | ENPPSPPT*S*PAAPQPR | NP_080653 | -0.26 | -0.1 | 0.08 | |
hypothetical protein LOC67788 | 6330577E15Rik | T70 | ENPPSPPT*SPAAPQPR | NP_080653 | 0.39 | |||
hypothetical protein LOC238330 | 6430527G18Rik | S618 | AALMSVADTLGTAHS*PK | NP_665835 | -0.42 | -0.12 | ||
hypothetical protein LOC238330 | 6430527G18Rik | S526 | AS*PEPPDSAESALK | NP_665835 | 0.03 | |||
hypothetical protein LOC238330 | 6430527G18Rik | S526 | KAS*PEPPDSAESALK | NP_665835 | 0.63 | -0.1 | 0 | |
hypothetical protein LOC238330 | 6430527G18Rik | S532 | KASPEPPDS*AESALK | NP_665835 | ||||
hypothetical protein LOC238330 | 6430527G18Rik | S195 | LPNGLGGPNGFPKPAPEEGPPELNRQS*PNSSSAATSVASR | NP_665835 | 0.96 | -1.73 | ||
hypothetical protein LOC238330 | 6430527G18Rik | S636, S641 | NS*SSPVS*PASVPGQR | NP_665835 | ||||
hypothetical protein LOC238330 | 6430527G18Rik | S636 | NS*SSPVSPASVPGQR | NP_665835 | -0.41 | -0.19 | ||
hypothetical protein LOC238330 | 6430527G18Rik | S637 | NSS*SPVSPASVPGQR | NP_665835 | 0.54 | |||
hypothetical protein LOC238330 | 6430527G18Rik | S638, S641 | NSSS*PVS*PASVPGQR | NP_665835 | -0.98 | -0.1 | 0.03 | |
hypothetical protein LOC238330 | 6430527G18Rik | S638 | NSSS*PVSPASVPGQR | NP_665835 | -0.43 | -0.31 | -0.19 | * |
hypothetical protein LOC238330 | 6430527G18Rik | S641 | NSSSPVS*PASVPGQR | NP_665835 | -0.42 | |||
hypothetical protein LOC238330 | 6430527G18Rik | S195 | PAPEEGPPELNRQS*PNSSSAATSVASR | NP_665835 | -0.45 | |||
hypothetical protein LOC238330 | 6430527G18Rik | S195 | QS*PNSSSAATSVASR | NP_665835 | -0.67 | 0.8 | ||
hypothetical protein LOC238330 | 6430527G18Rik | S526 | RKAS*PEPPDSAESALK | NP_665835 | 0.06 | |||
hypothetical protein LOC238330 | 6430527G18Rik | S636, S637 | RNS*S*SPVSPASVPGQR | NP_665835 | 0.53 | |||
hypothetical protein LOC238330 | 6430527G18Rik | S636, S638, S641 | RNS*SS*PVS*PASVPGQR | NP_665835 | -1.23 | |||
hypothetical protein LOC238330 | 6430527G18Rik | S636, S638 | RNS*SS*PVSPASVPGQR | NP_665835 | 0.06 | |||
hypothetical protein LOC238330 | 6430527G18Rik | S636 | RNS*SSPVSPASVPGQR | NP_665835 | 3.32 | |||
hypothetical protein LOC238330 | 6430527G18Rik | S637, S638 | RNSS*S*PVSPASVPGQR | NP_665835 | 0.89 | -0.02 | ||
hypothetical protein LOC238330 | 6430527G18Rik | S637, S641 | RNSS*SPVS*PASVPGQR | NP_665835 | 0.03 | |||
hypothetical protein LOC238330 | 6430527G18Rik | S637 | RNSS*SPVSPASVPGQR | NP_665835 | 0.08 | 0.03 | ||
hypothetical protein LOC238330 | 6430527G18Rik | S638, S641 | RNSSS*PVS*PASVPGQR | NP_665835 | 0.03 | |||
hypothetical protein LOC238330 | 6430527G18Rik | S638 | RNSSS*PVSPASVPGQR | NP_665835 | -0.38 | 0.21 | ||
hypothetical protein LOC238330 | 6430527G18Rik | S313 | RPGS*VSSTDQER | NP_665835 | -0.29 | |||
hypothetical protein LOC238330 | 6430527G18Rik | S13 | RQS*CYLCDLPR | NP_665835 | 7.92 | |||
hypothetical protein LOC238330 | 6430527G18Rik | S69 | S*PGPPPPVGVK | NP_665835 | -0.99 | -0.21 | 0.05 | |
hypothetical protein LOC238330 | 6430527G18Rik | S618 | SVADTLGTAHS*PK | NP_665835 | -0.11 | |||
hypothetical protein LOC238330 | 6430527G18Rik | T589 | T*TPPESAPQNGPSPM | NP_665835 | ||||
hypothetical protein LOC238330 | 6430527G18Rik | T589 | T*TPPESAPQNGPSPMAALMSVADTLGTAHSPK | NP_665835 | 0.25 | |||
hypothetical protein LOC238330 | 6430527G18Rik | T590 | TT*PPESAPQNGPSPM | NP_665835 | ||||
hypothetical protein LOC238330 | 6430527G18Rik | S618 | TTPPESAPQNGPSPMAALMSVADTLGTAHS*PK | NP_665835 | -0.1 | |||
hypothetical protein LOC212163 | 8030462N17Rik | S66 | RDS*SESQLASTESDKPTTGR | NP_848785 | 0.72 | |||
hypothetical protein LOC212163 | 8030462N17Rik | S145 | SRS*ESETSTMAAK | NP_848785 | 0.58 | |||
hypothetical protein LOC329540 isoform 2 | 8430427H17Rik | Y49 | SKY*QRIAEVLQGGGGTGAGSGPAAGEK | NP_001127772 | ||||
kazrin isoform 1 | 9030409G11Rik | T445 | T*PMSHWK | NP_653114 | <-10 | |||
PREDICTED: hypothetical protein LOC77671 | 9130230N09Rik | S5 | S*SAPPRRAGGVPR | XP_979712 | -5.38 | |||
hypothetical protein, 12H19.01.T7 | 9930013L23Rik | S645 | SGTLLPSDRDS*RMCK | NP_109653 | ||||
250 kDa substrate of Akt | A230067G21Rik | S376 | RLSNSS*LCSIEEEHR | NP_001028520 | ||||
hypothetical protein LOC320484 | A430107D22Rik | S455 | VRCLRVLPS*ERYK | NP_848900 | ||||
oocyte-testis gene 1 | A630007B06Rik | T153, S155, S157, Y159, T164 | T*AS*AS*LY*DTDCT*R | NP_739563 | ||||
hypothetical protein LOC212427 | A730008H23Rik | S491 | YCLS*PQR | NP_766093 | 0.29 | |||
PREDICTED: hypothetical protein LOC320291 | A730036E13Rik | T140 | TPGPPT*GARGR | XP_994751 | ||||
specifically androgen-regulated protein | AA986860 | S132 | AGSYS*LPR | NP_808272 | -0.13 |